CAZyme Information: jhhlp_005128-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005128-t41_1-p1
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785		88428.38	6.8009

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000696:62205-64631(+)

Full Sequence      

MTPPFLPTTAQWIWAPNYSDDADPGRFVLFRRVFELQNAIPQGKVLLYVSADTRYRLYLN
GKSISFGPCKSYPGRWNYEEVDIAPWLRQGRNVLAARVLRLSPSQHGCLSMMRTPLPGLI
VQATIEGQDISTNDAWRSKIDEATTLIGDKEWDFRLGPCFLGLNEKVDGKKLEAGWLDAD
YDDSAWKGATIKSYRRKMSPAQEFPRLFPREIPAMTETPREFHRVVKSSSAVSFEQWSQF
LSGKSGTIIPAKSNISVDIEAETLTTGFLDLCAMVGNQKEPATLQILYSECYESPMDNGE
PRRKRNRVDYEGGQLYGASDWYTLHDGVNHYSPFWFRAFRYIRLTINTGDAPVKLVSLSY
RQTHYPLDITAGVSTSSPLFSKLWDISVTTLQNCMHETYEDCPYYEQQQFAMDSRSQILF
TYVLSGDDRLARKTMREFHASRRDDGLIEAQWPSPARQTNMPSFSLFWVLMVHDHMVYFG
DESLVKDYIGTVDGILNYFDKRLNKSGLVGRFEADCWGFVDWVDGWFTPGHGFLGAAIPK
AYYSKGAATFHSLLYAYALLQARELCLFLGRRDTADEYSARHQAIIRAVRTHCLDASTGV
FLDGPGATGELSQHTQIFAVLTGCVQGDAAKDLITRTILEPGTMARASFAMSFYAFRAAS
AAGAYEACWAELIKPWEKMVEQNLTTWAESESMARSDCHGWSATPLYEIATEILGVRQRS
DAYVKRLGLGGAGIRIAPRQGLLEDVRGRVCIKASSRGQPGEVVEVAWHRGVKPRILCNA
EVDII

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	264	752	5.4e-93	0.9047619047619048
CBM67	10	191	1.6e-37	0.9431818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	5.79e-18	370	638	3	255	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
400715	Bac_rhamnosid_N	3.34e-08	47	191	8	152	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ52007.1|GH78	6.93e-269	4	784	5	780
BCS25990.1|GH78	1.22e-233	11	771	10	760
CAK49119.1|GH78	2.65e-233	10	771	10	755
BCS15768.1|GH78	8.84e-232	1	750	1	748
BCS04174.1|GH78	8.84e-232	1	750	1	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	9.15e-44	10	723	8	886	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	8.01e-17	253	709	91	538	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6I60_A	8.62e-10	29	517	178	613	Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

jhhlp_005128-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000001

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_005128-t41_1-p1.