CAZyme Information: jhhlp_005036-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005036-t41_1-p1
• CAZy Family: GH18|CBM24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		66844.37	5.3981

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000095:801900-803816(-)

Full Sequence      

MRSRTFRLLVCGLALPAHAASHGSENNTTAALPYKDSKLCIDERVDDLLSRMTLEEKAGQ
MFHARTSLVNNSFDSNILNLVSKKHITHYVFSGGVNDARVVAEWQNKLQKFASESGLGIP
ITISSDPQHGWTDDAAVSNFGASFSRWTEPMGIAALRSPELARTFANIAREEYVAVGIRQ
ALHPQVDLATEPRWGRMGATMGEDANLTSALLVEYIKGFQGDTIGPHSVITTTKHFPGGG
PMEDGEDSHFAWGKNQTYPGRNWDYHLIPFKAAIAAGTRQMMPYYSRPIGMHWEEVAFGF
NKGVVTNLLKEEMGFEGIVVSDWGIITDRAWGLEDKTELERTRRAIEAGCDILGGETKPG
LIVQAVREGLLGIERIEQSVRKLLREKFELGLFDNPFVDPDAAERVVGNQYFSRLGNETQ
RSSLTLLTNTDDYLPLPASARDHRFYVEGISKSAMEARNLTVVDTPEEADLALLRFVSPF
KPTSGGGLMSSINNGSIEFNTTEKARQAHIYATLPTVVDIKLNRAAAVPEIAEAATALFV
SYGSSHDAFLDVVFGIDGWSPKGQLPFDLPRSMAAVEASFEDVPFDSEDPLFRFGHGLRY
SGKCKDS

Enzyme Prediction     

EC	3.2.1.21:5	3.2.1.38:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	353	1.7e-56	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	7.68e-54	52	440	1	354	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.65e-48	53	385	1	315	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	2.33e-36	9	441	9	412	beta-glucosidase BglX.
178629	PLN03080	3.48e-15	1	443	3	422	Probable beta-xylosidase; Provisional
235417	PRK05337	6.38e-06	231	353	162	277	beta-hexosaminidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02341.1|GH3	0.0	33	605	28	590
QKD53531.1|GH3	9.53e-318	33	607	27	600
QGI92047.1|GH3	1.99e-313	33	607	27	622
QGI61148.1|GH3	1.99e-313	33	607	27	622
QPC63385.1|GH3	1.02e-312	34	607	28	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	4.35e-48	28	600	26	614	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
1LQ2_A	7.45e-43	34	598	5	597	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]
1EX1_A	7.72e-43	34	598	5	597	Beta-d-glucan Exohydrolase From Barley [Hordeum vulgare],1IEQ_A Crystal Structure Of Barley Beta-D-Glucan Glucohydrolase Isoenzyme Exo1 [Hordeum vulgare],1IEV_A Crystal Structure Of Barley Beta-d-glucan Glucohydrolase Isoenzyme Exo1 In Complex With Cyclohexitol [Hordeum vulgare],1IEW_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 2-deoxy-2-fluoro-alpha-D-glucoside [Hordeum vulgare],1IEX_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare],1J8V_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with 4'-nitrophenyl 3I-thiolaminaritrioside [Hordeum vulgare],3WLH_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare],3WLJ_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 3-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLK_X Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with 4-deoxy-glucose [Hordeum vulgare subsp. vulgare],3WLL_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with PEG400 [Hordeum vulgare subsp. vulgare],3WLM_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with octyl-O-glucoside [Hordeum vulgare subsp. vulgare],3WLN_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme EXO1 in complex with octyl-S-glucoside [Hordeum vulgare subsp. vulgare],3WLP_A Crystal Structure Analysis of Plant Exohydrolase [Hordeum vulgare subsp. vulgare]
6JGQ_A	8.09e-43	34	598	9	601	Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6JGR_A Crystal structure of barley exohydrolaseI W434Y in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGS_A Crystal structure of barley exohydrolaseI W434Y mutant in complex with 4I,4III,4V-S-trithiocellohexaose. [Hordeum vulgare subsp. vulgare],6JGT_A Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 6-thio-beta-gentiobioside. [Hordeum vulgare subsp. vulgare]
6JGE_A	8.09e-43	34	598	9	601	Crystal structure of barley exohydrolaseI W434A mutant in complex with methyl 2-thio-beta-sophoroside. [Hordeum vulgare subsp. vulgare],6K6V_A Crystal structure of barley exohydrolaseI W434A mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare],6KUF_A Crystal structure of barley exohydrolaseI W434A mutant in complex with glucose. [Hordeum vulgare subsp. vulgare],6L1J_A Crystal structure of barley exohydrolaseI W434A mutant in complex with 4'-nitrophenyl thiolaminaritrioside [Hordeum vulgare subsp. vulgare],6LBB_A Crystal structure of barley exohydrolaseI W434A mutant in complex with 4I,4III,4V-S-trithiocellohexaose [Hordeum vulgare subsp. vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NGU6|BGLC_ASPFN	1.06e-246	22	607	30	629	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
sp|Q2UFP8|BGLC_ASPOR	6.53e-244	34	607	46	633	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
sp|Q5BCC6|BGLC_EMENI	2.16e-237	31	600	34	615	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
sp|Q46684|BGLX_DICCH	1.25e-117	33	598	57	652	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
sp|T2KMH9|PLH34_FORAG	6.06e-42	29	601	24	639	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000391	0.999579	CS pos: 19-20. Pr: 0.9704

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_005036-t41_1-p1.