CAZyme Information: jhhlp_005008-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005008-t41_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
502		57234.08	5.0793

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000095:705443-707052(+)

Full Sequence      

MVCSAQVSPDAGIPFHYPIPFSNYISLIMPLPANFRLGFATASYQVEGAVAEDGRGPSIW
DTFCHLEPTRTKGANGDIACDHYHHLEEDLDLLKKYGSDMYRFSISWSRVIPLGGRDDPV
NEAGIAFYNRLIDGCLARGITPWVTLYHWDLPQGLHDRYGGWLSVDESQKDFERYARLCY
ERFGDRVKHWITLNEPWIVAIFGYATGGNAPGRSSINPQSTEGDTSTEPWIVGKALIMSH
ARAVAAYKKDFRQSQKGQIGVSLNGDYYEPWDANEPKDVEAAERRMQFHIGWFANPIFLG
QDYPQCMRDQLRDRLPTFSSDEMALLQSAECDFYGMNYYTGQFARHRDSPAPDTDYIGNL
DELQSNKAGEEVGSESGIHWLRSCPNLFRKHLSRVYKLYRKPIVITENGCPCPGEDKMTR
EESVQDDYRIKYFEDHLDAVGKAINDDGAVVEGYFAWSLMDNLEWSDGYGVRFGVTYTDY
EILERTPKRSALLLRQLVDQRK

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	31	500	5.7e-159	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	2.80e-171	30	498	4	448	Glycosyl hydrolase family 1.
274539	BGL	1.09e-165	32	492	1	424	beta-galactosidase.
225343	BglB	1.14e-148	29	499	2	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.98e-103	31	491	28	473	beta-glucosidase
184102	PRK13511	5.78e-103	31	502	5	467	6-phospho-beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61576.1|GH1	0.0	31	502	6	477
UPK99727.1|GH1	0.0	31	502	4	475
CEF83492.1|GH1	0.0	31	502	4	475
QPC64692.1|GH1	0.0	31	502	4	475
CZS73216.1|GH1	0.0	31	502	4	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KHT_A	1.00e-276	29	497	19	487	Chain A, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_B Chain B, Glycoside hydrolase family 1 [Trichoderma reesei QM6a],6KHT_C Chain C, Glycoside hydrolase family 1 [Trichoderma reesei QM6a]
5JBO_A	2.91e-276	29	501	6	478	Trichoderma harzianum GH1 beta-glucosidase ThBgl2 [Trichoderma harzianum]
4MDO_A	5.28e-177	29	499	24	493	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	7.33e-174	31	500	3	461	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	9.68e-172	29	500	1	461	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	4.40e-175	31	496	11	469	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	2.53e-152	31	494	6	452	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	1.49e-141	32	494	23	507	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q8L7J2|BGL06_ORYSJ	2.77e-134	32	498	51	519	Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
sp|Q9FLU8|BGL32_ARATH	6.68e-133	32	491	38	502	Beta-glucosidase 32 OS=Arabidopsis thaliana OX=3702 GN=BGLU32 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999703	0.000319

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_005008-t41_1-p1.