CAZyme Information: jhhlp_005005-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_005005-t41_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	NLAX01000095|CGC4	59879.50	4.7249

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000095:698915-700793(-)

Full Sequence      

MKFILLALTGVTIAACSPLNEGRSEHQKFNAPSCRFGLEWSQQDVLDRTDDFIWDLLYWE
GKFHQNDVAYNTVNGMTYDGTQLDWVTGERTQKHVFSAASKEALQIMLYAQAIVGSKEAA
RFLTPDDPASAPAFAASIMETKLKAYLQFNQTYPGFGGFLPWIKTNETEVTVQDGWDNRV
PGLDNGHVKQELIWAVYACIEALQRLPGPEFQKLAQGWQSWLDYTASTVAKIFYIGNGRV
CAVTKISDQALPVWHANQTYNCEDTVYLDDPYEGELFTYFIEFFGDLSKKDKQKLWEYKR
AKLEKDEYNQGGVGPITVRKGYWFSSHEIWNQMELPYYDVDIVRRLFLNGERARTCNSVV
TKSPGLYASVNNSTDPETDTIIGYISPAGIPSIASQQEQYHDVVTPYGAYPVVLFDKAVG
LAWWRNMIIGKKMQNPYGSTESTRVDGELVSALVTWDSKVTTVVALLGGVTDLVRDRMRS
DGIYDRFLEITEREHVRVFGRHLKGEDIDLCLPADTVPDAGLEDFTACQA

Enzyme Prediction     

EC	3.2.1.71:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH162	33	528	7e-203	0.9958677685950413

CDD Domains     

jhhlp_005005-t41_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99704.1|GH162	0.0	6	530	9	528
QPC64695.1|GH162	3.94e-306	1	529	1	522
QPC73588.1|GH162	1.60e-305	1	529	1	522
CZS73213.1|GH162	6.50e-305	1	529	1	522
SCB65247.1|GH162	9.23e-305	1	529	1	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IMU_A	4.34e-236	32	529	13	505	The apo-structure of endo-beta-1,2-glucanase from Talaromyces funiculosus [Talaromyces funiculosus],6IMU_B The apo-structure of endo-beta-1,2-glucanase from Talaromyces funiculosus [Talaromyces funiculosus],6IMV_A The complex structure of endo-beta-1,2-glucanase from Talaromyces funiculosus with sophorose [Talaromyces funiculosus],6IMV_B The complex structure of endo-beta-1,2-glucanase from Talaromyces funiculosus with sophorose [Talaromyces funiculosus]
6IMW_A	1.24e-235	32	529	13	505	The complex structure of endo-beta-1,2-glucanase mutant (E262Q) from Talaromyces funiculosus with beta-1,2-glucan [Talaromyces funiculosus],6IMW_B The complex structure of endo-beta-1,2-glucanase mutant (E262Q) from Talaromyces funiculosus with beta-1,2-glucan [Talaromyces funiculosus]

Swiss-Prot Hits     

jhhlp_005005-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000793	0.999180	CS pos: 16-17. Pr: 0.8299

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_005005-t41_1-p1.