CAZyme Information: jhhlp_004996-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_004996-t41_1-p1
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433	NLAX01000095|CGC6	50017.07	9.7995

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000095:669513-670939(-)

Full Sequence      

MASSPPLLQHQQQAHGAHRFYFAYLRRHRRRIAILIIITTLLYHFFFISGPLSQINGPRP
TSRKITPERDLDAQPHYIHRSEFRANPDVAYEEKLDNALLDLERRVLADVGSGGVAHEKQ
RKLWQILLGPTAQRGADSMLFEEKNPEWDYTVLRDVWANNFVNATFSTIPDLVTLYHEYP
YDVLRADLLRYLVLWFYGGYYADTDIKPARPIDACPSLKPVLPPHADRPNISLVIGIEID
EPWASSRLMRQWHWIRTYGFVQYNLYAPQRFSPLLRRAIVRVLAHTKRHHAKSWLFGPRY
DEKTILEITGPGVFTDAILDVLSETLPPTHPFIQQSLSADAEVGDLSIAGTRQAKRQRVT
WAPFHHLEQPLWVDATEAAEGKSFGGLGVLPINVWGNGQRHSGAENFRSRQACVNHRFKG
TWKKTWWQRWRGI

Enzyme Prediction     

No EC number prediction in jhhlp_004996-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	143	215	7.5e-16	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	1.05e-10	143	213	13	84	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
226297	OCH1	6.61e-09	59	214	41	176	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21634.1|GT32	1.80e-150	64	429	46	411
EAA64318.1|GT32	1.40e-145	53	429	39	414
QMW37982.1|GT32	2.46e-145	67	426	51	407
UCK58385.1|GT32	2.46e-145	67	426	51	407
QMW25899.1|GT32	4.00e-144	67	426	51	407

PDB Hits     

jhhlp_004996-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	9.12e-24	141	423	127	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	4.81e-18	140	370	153	347	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q9UTR6|OCH1_SCHPO	5.18e-17	145	423	169	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	1.08e-16	145	424	129	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.88e-08	96	205	62	167	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000014

TMHMM  Annotations     

Start	End
32	54