CAZyme Information: jhhlp_004923-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_004923-t41_1-p1
• CAZy Family: GH162
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		37866.56	4.4803

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000095:365935-367057(-)

Full Sequence      

MKSSTALLAALLSARSFAWPSVWPYEKRTTALPSNWKPGVKWQIVIHAPIDIRTTVIPTE
AQVWDIDYFHALAHPEIIPALRTPAPGVDNVVLCYINVGAIEEYEADYKNFPKDAIGNSY
EEYPEGWIDVRREDVVEFMKKRLVKAAEAGCDGVDADNIDGYDWDEPGVDKTGWSLTQKD
LINYVTTLADYAHSIDTLRGVPLMFGQKNAPHLAPHLVNIVDFAVLEDCQGLNGRLPGVH
EAYCHDFQPFVTGEKRADGKKLPVFEIEYPGSTENGSTNLTRADWEYYCNRDKVEVGNLD
FSQVIKHESEQIDGWVQYCLDNEQEGKFWTVTLPIG

Enzyme Prediction     

No EC number prediction in jhhlp_004923-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	42	269	2.7e-42	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	1.05e-57	41	307	1	216	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	1.39e-14	37	214	58	220	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK97753.1|GH114	2.23e-70	34	319	33	305
EAQ83415.1|GH114	3.69e-68	1	323	1	314
QKD47958.1|GH114	4.10e-68	34	319	35	307
QGI89288.1|GH114	4.64e-68	34	319	51	323
QGI58377.1|GH114	4.64e-68	34	319	51	323

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	1.96e-31	24	319	25	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	2.83e-31	24	319	42	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

jhhlp_004923-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003327	0.996656	CS pos: 18-19. Pr: 0.9579

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_004923-t41_1-p1.