CAZyme Information: jhhlp_004892-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_004892-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608	NLAX01000095|CGC4	66016.43	5.0371

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000095:205097-207097(+)

Full Sequence      

MGGPVTELPSNLDEVDVIIVGGGTAGCVVASRLSDADPNLSILVIEGGQNNYQDPTVVLP
LLMLMSLLPNSKNTLAYIGSKESQIGNREVVVVSGGILGGGSSVNLLTYSRPQREDLDAW
NIPGWSTDEMIPYFKKFETYYGAGLPATHGDSGPIEISAGTFNVERSQNDFIQAAGQLGW
PEVKDLMDMDTNNAVYRNLRYINRDGIRQDSAHCYLHPRLQDGAHPNLNVLVQNQVVRVL
FDKDKRANGVEFHRNPAFSDGQDAAMDLKTVKARKLVIISSGGLGSPLVLERSGIGGADV
LSRAGIKPIVDLPGVGSNYMDHHLFTYPYKSSLNPDETADALYGGRRDFNEAIGSKDKIL
GWNVADVTGKIRPTESEVAALGPDFQAAWERDYKDKPNKPLTIITSLNAFPGDPTDVDPG
QYMSCSTFTLYPYSRGHIHITGPKVSDPPDFVTGYLQDERGIDLKKAVWAYKKQRELFRR
MDVYRGEYAPSHPAFPAGSAAASIETSEPLKDVKDIVYSAEDDAIIEEWLRRNVGSTWHS
MGTCKMGAKETLGVVDPKLNVHGVAGLKVADLSICPDNVAANTAATAFAIGEKAADIFIE
ELGLRKGT

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	603	1.6e-259	0.9983050847457627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	9.18e-66	14	596	7	531	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.89e-63	14	597	5	530	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.21e-28	432	576	1	125	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.10e-23	101	322	30	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.30e-08	220	574	227	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX58265.1|AA3_3	1.70e-260	3	606	2	605
ANH22749.1|AA3_3	1.66e-249	3	602	2	604
BCS13902.1|AA3_3	1.09e-248	3	604	2	599
BCS02218.1|AA3_3	1.09e-248	3	604	2	599
QRD82197.1|AA3_3	2.96e-248	1	602	39	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3G_A	3.17e-132	13	608	5	630	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	6.31e-132	13	608	5	630	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	9.89e-131	13	603	5	637	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6YS2_AAA	1.21e-51	14	595	7	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	6.01e-51	14	595	7	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	2.18e-138	13	603	5	637	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|P04841|ALOX_PICAN	1.37e-133	13	603	5	638	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|F2QY27|ALOX1_KOMPC	5.09e-130	13	603	5	637	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04842|ALOX1_KOMPG	5.09e-130	13	603	5	637	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|C4R702|ALOX2_KOMPG	2.23e-128	13	603	5	637	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999726	0.000290

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_004892-t41_1-p1.