CAZyme Information: jhhlp_004841-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_004841-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		25278.79	3.8653

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000095:40788-41658(+)

Full Sequence      

MKSSPILAMAVLGNGVMAVTTTLPPSAGVTSADAAIPVETAFDGQMVRFERSSNVCQGQT
ETGEDDAMFILEDGATLSNIIIGASQAEGVHCRGTCTLNNVWWADVCEDAATFKQADGTS
YINGGGAFHADDKIFQFNGRGTIVVSGFYAEDYGKLVRSCGNCDDNGGPRNVVVEKSVAV
DGGVLCGINTNYGDTCQISDTCQDDEKTCDLFEGNSNGDEPQKIGSGPDGEFCTVSNLTS
DC

Enzyme Prediction     

EC	4.2.2.2:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	33	214	1.9e-76	0.9484536082474226

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	3.26e-109	20	219	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI88269.1|PL3_2	2.88e-130	1	242	1	240
QGJ01821.1|PL3_2	2.88e-130	1	242	1	240
CCT75670.1|PL3_2	2.88e-130	1	242	1	240
QGI70931.1|PL3_2	2.88e-130	1	242	1	240
ACS78056.1|PL3_2	5.82e-130	1	242	1	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	3.50e-30	36	161	11	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B90_A	1.39e-24	49	236	9	219	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	5.65e-24	26	236	100	337	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4U49_A	2.77e-21	58	236	143	340	Chain A, Pectate lyase [Pectobacterium carotovorum],4U49_B Chain B, Pectate lyase [Pectobacterium carotovorum],4U4B_A Chain A, Pectate lyase [Pectobacterium carotovorum]
4EW9_A	8.45e-21	15	162	6	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B024|PLYF_EMENI	4.19e-66	24	225	28	229	Probable pectate lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyF PE=3 SV=2
sp|Q5ATC7|PLYH_EMENI	1.26e-63	23	242	40	260	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|A1D5E3|PLYF_NEOFI	9.15e-63	31	225	35	230	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1
sp|B0Y953|PLYF_ASPFC	1.83e-62	31	225	35	230	Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyF PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	2.29e-62	23	242	42	264	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002547	0.997453	CS pos: 34-35. Pr: 0.5915

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_004841-t41_1-p1.