CAZyme Information: jhhlp_004832-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_004832-t41_1-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1542		168969.13	5.1983

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000095:13275-18594(-)

Full Sequence      

MKPTWVSLFLLFSAARGAIDIEGARVVEPLSSNDPSPIADVLTYIPDQHDCPLPCHTDYS
NIHRWTPYYSVERLQRCELPMLLHFSALRPLDDPQTDIFIRACTLGTPPDDAKDRTVLQA
TAISIDNPKHSTELYQASLDTEPACAIDGIAISHGLPFTTGGGEGLVSAKEITSLLDGIK
DFFDAKDNCDETFLFAYYKDIVASLHIGAGLGKPTVSSAIQAVAGRLQTGGAFANQTVAQ
LCRIERSPETTFGIFIDTTRDIFKAQRAAAAWSQGSCVPENDIPLPLNEEVLEIDVFDIA
ATPLEVEGRNHTIISNKTTPITVRSHHRRSDTLWRRPGVLGKRATCAYIPVMRADGCASL
AAKCSIRGADFLKYNPKEDLCSTLKEGDYVCCSAGDPYTEPKPEPPKQNPDGSCAVHLIT
ATDTCEKLGKTFGLTEAEIESFNKGKTWGWTECRGMLATYNMCLSTGTPPLPPPQQGLQC
GPQVPGTVWTDPSVPMAELNPCPLKACCSNWGYCGPFPTHCDIHAPPGGGPGTKLPEFSS
TCISNCGNEIKQNSGPPVVFSRIGYYESWNMERECLWLSAKNANTDGTYTHIHWAFAEID
PATWSVVIKDPHGQWSAFKALPNVKKIVSFGGWAYSTEPATYNIIRQAIITNRDTFATNA
AKFITDEGLDGIDIDWEYPGAPDIYVDGQPIGQAGDGVAYLRFLTVLKSKLPSHSVSIAA
PASYWYLRAFPIDRIAVVIDYIVYMTYDLHGQWDYGNPNAFDSCASGKCIRSHVTKAGVP
NNKIFVGEASYGRSFRMAIDDCWGPMCEFTGTRTESDANPGRCTKTGGYISNAEINEIIR
AGTGRLLHDHESNTDVLLYKGDYVSYMTPLTKDTRRVDWKALNFAGTIDWAVDLQAFGAD
DMDIPADPPPVGAEGCISGDSGDFNADSLCQFSCSYGFCPENTCTCLQTGPVRELPRVVS
TMDFVSWNSFDVDYQRLCRFACKYGFCPQDTCGTPIVDEWDDGSVDDNRPTGGLWDKEKN
YDENRKQCFIYQTGRNRDESASMCYEACRETIEAAQAEGRTTNYGCTGFWPLDEPIPWTT
YPGKHGPDYVYAVGRCTCDNNAINLLADLVIDALPIIAQIGCYVLMSAFKLVLDIGLQAI
PGAGKILDAGLDAATTAAQLISYAYPPEEDPVGAFEWWLSPCGGSDLVPDDIKQVFDILS
TVADGVSSFQTPKNIRKGSGKKGDAANPMDRSKPKAGTGSGPNGTGSSGVTKRRKCKIPT
GKSTYILGLAKNTLREQECVAVPGGGGVSTTSKHDYVITSVEFGPTPTTMTRDCEKRFSQ
ACYHYSSAIEHNSAWGAIKCPHGNVKCPWKARPGPRAWEAQHDNTWKRSNGRPYQGSCEI
DEFPPRYLLSDQSPEMVNAGKSGGQLMRYLPQPDNFGGGQIWKGFCFKPHIKQFNTPAKF
KAAWNTSPLSKRDRTVNPGEVTEQVEILIQVTPYFALSFEHSRAPNIPPFDDGLWANSCW
PNGMAPNDPGFALWSWDPWYKRNSPQPKWDFSKSYNQGSNGS

Enzyme Prediction     

EC	3.2.1.14:3	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	563	894	1.6e-42	0.9222972972972973
CBM24	916	992	2.8e-19	0.9736842105263158

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	2.25e-156	562	895	2	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	5.95e-48	563	894	3	333	Glyco_18 domain.
395573	Glyco_hydro_18	6.30e-48	563	893	3	305	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.36e-38	563	796	2	267	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119349	GH18_chitinase-like	1.86e-33	563	749	2	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYT05739.1|CBM18|CBM24|CBM50|GH18	0.0	7	1542	9	1520
UKZ57771.1|CBM18|CBM24|GH18	0.0	16	1542	20	1500
QPH01779.1|CBM18|CBM24|CBM50|GH18	0.0	8	1542	4	1519
AIT18865.1|CBM18|CBM50|GH18	0.0	13	1541	14	1541
CZS72048.1|CBM18|CBM24|CBM50|GH18	0.0	1	1541	1	1548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUS_A	6.01e-25	565	897	7	344	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WVF_A	6.16e-24	565	897	7	344	Crystal structure of a mutant insect group III chitinase (CAD2-E647L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVG_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)5 (CAD1-E647L-(GlcNAc)5) from Ostrinia furnacalis [Ostrinia furnacalis]
1HKK_A	1.44e-22	590	897	31	344	High resoultion crystal structure of human chitinase in complex with allosamidin [Homo sapiens]
1HKI_A	1.46e-22	590	897	31	344	Crystal structure of human chitinase in complex with glucoallosamidin B [Homo sapiens],1HKJ_A Crystal structure of human chitinase in complex with methylallosamidin [Homo sapiens],1HKM_A High resolution crystal structure of human chitinase in complex with demethylallosamidin [Homo sapiens]
1LG1_A	1.46e-22	590	897	31	344	Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose [Homo sapiens],1LG2_A Crystal Structure Of Human Chitotriosidase In Complex With Ethylene Glycol [Homo sapiens],1LQ0_A Crystal Structure Of Human Chitotriosidase At 2.2 Angstrom Resolution [Homo sapiens],6ZE8_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_B Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_C Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_D Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_E Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_F Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	2.65e-84	345	891	192	708	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q6RY07|CHIA_RAT	3.68e-22	560	897	22	367	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q91XA9|CHIA_MOUSE	8.74e-22	560	897	22	367	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
sp|Q13231|CHIT1_HUMAN	2.59e-21	590	897	52	365	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q6TMG6|CH3L1_SHEEP	4.76e-19	560	897	1	337	Chitinase-3-like protein 1 OS=Ovis aries OX=9940 GN=CHI3L1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999716	CS pos: 17-18. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_004832-t41_1-p1.