CAZyme Information: jhhlp_004574-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_004574-t41_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1426		155764.09	5.1671

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000010:5159837-5164844(-)

Full Sequence      

MLSRARSAGVINLWHRPSWAGPIQDRATAPETMAHNNGDSASPAWDAPPPPRESIDDQAA
LVSDGFSMPDLEEARDAPPPYGGDLHDQLQFSQSGFEAGANVTDDGRVNININQKNRKFS
DFLGHTLRAQVIADAAAPPPSSTPYIPPTLGGEPGQTPPPKLNVVIQIVGSRGDVQPFVA
LGKVLKETYGHRVRLATHATFQKFVEENGLEFFNIGGDPAELMAFMVKNPGLMPGFDALR
SGEVSKRRRGMQDILMGCWRSCIEPGNGLGPALPPHRKGLEMNYDEEAILPGGPDHRPFI
ADAIIANPPSFAHIHVAEKLGIPLHMMFTMPWSPTRAFPHPLANILSSNTDDVMTNYVSY
ALVEMMTWQGLGDVINRFRNTVLDLEPLSLIWAPGLLTRLQIPYTYCWSPALIPKPNDWQ
RNIDIAGFFFLDLANSYTPDPSLVEFLEAGPPPVYIGFGSIVVDDPNALTRLIFDAIHIA
GIRALVSKGWGGLGADDVGIPDGVYMIGNCPHDWLFRNVSCVVHHGGAGTSAAGIYAGKP
TVVVPFFGDQPFWGAMISRAGAGPEPVPYKDITAEKLAEAIKTALKPETAEKARELGEKI
REEKGADLGGKSFHDQLNFKALRCSLIPTRVATWRVRRTKVLLSPFAAEALVRERVIQYS
DLKLWRSQEYNTEGQPWDPISAVTSSLLMDLSELALAVADFPRGIFHSKDSKDPKDKDAA
GSVGSSRGRRGKSVDMSNTTLSASTAPSTADSILPGYVELPSAQAGDVGPVELPGDMPAP
PAGPVELPSHTPDELPAFATDISNQGQTSRPATARSGPSPTTPQRGNSGLLTPSVTVTSD
PIGEGSAGPSRSSFNLPGSPRRPRSASRGTSPYTSPSTRDENPYRDINIEDLRGAGTSVR
RIVTTGVKSPMNFCLGLAKGFRNAPKLYNDDTVRPTEKVTGLASGFKVAGKEFGFGLYDG
ISGLVTQPIKGAEKEGGIGFVKGFGKGLSGIVMKPAAALWSIPAYTMQGAYMEMKNKFAK
SMQNYIITSRMIQGAEDFEEATPEERAQVFLAWQNAKYDLKGLYQLKLKEAKDSKDSVTS
ESATGVAVPDGHRPRHHNLQTDLAALLAPKFGKDSIGHFDSHGRRLLKGKQAWKRGHIEA
DLDQHPNHDEEFERAIQTSVRETSRGDPEEDLLVERAIRASVSEFQRRGEPLPYPQQMMD
IKRPEGLGADLQEADLEITDEEYQALIEKAIQQSMVLHAAGLTGPHDHGDSDSEDDELKQ
VLERSKNERSTQSQHNEEDDEQFKKILEESRTNASAHRERTEQEEEELIRAIEASKVIAD
PSTLVQEEEERMLRRAIEESKAVHEAESTRAAAAKTEEEIVLEFVRKQSLAEEEFRKQRA
KAKGKMREEPEEEDDGDDDEELKRALEMSLEMNDKDGSKAGPSNLG

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	272	606	9e-60	0.7931937172774869

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.78e-84	162	615	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	6.07e-35	170	606	10	388	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.60e-18	164	339	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	1.96e-09	448	606	222	379	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	4.25e-07	934	1010	2337	2409	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC88278.1|GT1	0.0	60	1420	39	1318
UPK97830.1|GT1	0.0	51	1423	24	1277
UNI23646.1|GT1	0.0	42	1423	16	1289
QLI68802.1|GT1	0.0	56	1426	34	1291
QPC67286.1|GT1	0.0	89	1266	52	1163

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.23e-74	169	641	27	460	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.79e-74	169	641	47	480	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	6.06e-32	316	601	112	383	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	4.43e-26	162	601	1	366	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	4.94e-21	316	593	113	376	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	1.81e-119	160	617	154	574	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	8.65e-117	160	617	191	610	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	4.60e-76	157	619	990	1415	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|A7KAK6|ATG26_PICAN	6.55e-75	169	619	795	1205	Sterol 3-beta-glucosyltransferase OS=Pichia angusta OX=870730 GN=ATG26 PE=3 SV=1
sp|Q9Y751|ATG26_KOMPG	9.39e-74	161	619	760	1180	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.974265	0.025756

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_004574-t41_1-p1.