CAZyme Information: jhhlp_004560-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_004560-t41_1-p1
• CAZy Family: GH13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		42061.25	4.8781

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000010:5092343-5093551(+)

Full Sequence      

MVAALGSAAALLLAGTALAMPATNAPRQEAACDAKAALPTNVNSKTLPDPFKFWDGTPVA
TVEDFKCRQQQLQYALEQTELGDFPGPPDTLTASMTGQGLSISIGVGGNTATLSASVSKP
AGASGPVGAVIAYGFPSVSVPNNVATITFSNDQFAAQQGQASRGQGAFYNLFGRDHSAGA
LTAWAWGVGRIMDALEELGAETTGIDPTRVAVTGCSRNGKGAFIAGALEKRIALTIPQES
GSGGAACWRIADDEKAKGKNIQHAGQIVGENVWFSTRFNSWTSKINQDPVDHEALVALVA
PRGLYIPENDIDWLGPVAITGCMQAGQLIYKALGVPEHMGLSLVGGHNHCQFPSSQNAEI
NQFWDYFINGGTTKPSLISKSSATVNVADWAPWDVPTITGEW

Enzyme Prediction     

EC	3.1.1.-:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE15	46	369	3.9e-80	0.9925650557620818

CDD Domains     

jhhlp_004560-t41_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC88905.1|CE15	1.02e-173	8	399	5	395
BCL51557.1|CE15	1.86e-159	9	399	7	394
AEO68173.1|CE15	1.71e-153	8	399	5	397
AEO60464.1|CE15|3.1.1.-	1.39e-152	10	393	7	389
VBB82012.1|CE15	8.66e-146	8	399	5	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4G4G_A	2.69e-152	10	401	21	413	Crystal structure of recombinant glucuronoyl esterase from Sporotrichum thermophile determined at 1.55 A resolution [Thermothelomyces thermophilus ATCC 42464]
4G4I_A	7.67e-152	10	401	21	413	Crystal structure of glucuronoyl esterase S213A mutant from Sporotrichum thermophile determined at 1.9 A resolution [Thermothelomyces thermophilus ATCC 42464],4G4J_A Crystal structure of glucuronoyl esterase S213A mutant from Sporotrichum thermophile in complex with methyl 4-O-methyl-beta-D-glucopyranuronate determined at 2.35 A resolution [Thermothelomyces thermophilus ATCC 42464]
3PIC_A	2.40e-121	36	399	12	375	Chain A, Cip2 [Trichoderma reesei],3PIC_B Chain B, Cip2 [Trichoderma reesei],3PIC_C Chain C, Cip2 [Trichoderma reesei]
6RU2_A	7.66e-103	31	400	2	381	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor],6RU2_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor [Cerrena unicolor]
6RV8_A	8.14e-102	31	400	80	459	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor],6RV8_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJR6|GCE2_MYCTT	2.47e-153	10	393	7	389	4-O-methyl-glucuronoyl methylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=ge2 PE=1 SV=1
sp|Q7S1X0|GCE_NEUCR	2.96e-151	10	399	7	394	4-O-methyl-glucuronoyl methylesterase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=Cip2 PE=1 SV=2
sp|G0RV93|GCE_HYPJQ	1.94e-119	36	399	97	460	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1
sp|A0A1D8EJG8|GCE1_SODAL	2.10e-119	44	398	140	495	4-O-methyl-glucuronoyl methylesterase 1 OS=Sodiomyces alcalophilus OX=398408 PE=1 SV=1
sp|B2ABS0|GCE1_PODAN	5.29e-119	23	398	99	480	4-O-methyl-glucuronoyl methylesterase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=ge1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000351	0.999616	CS pos: 27-28. Pr: 0.7115

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_004560-t41_1-p1.