CAZyme Information: jhhlp_004269-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_004269-t41_1-p1
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853	NLAX01000010|CGC26	92899.15	5.1827

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000010:3804521-3807364(+)

Full Sequence      

MGNSGSQISTYATAGYYPAPYGGWTSDWSDSYQKAKSLVDQMTLAEKTNITSGTGIFMGM
RCVGNTGSAERVGFPQLCLGDAANGVRLADFVTVFPAGITTGATWDKSLMYERAVAMGRE
FRGKGVNIYLGPSVGPLGRKPKGGRNWEGFGSDPVLQAIGGSLTIKGVQEQGVIATIKHY
IGNEQEMYRMYNPFQSGYSANIDDRTLHEIYLWPFAEGVRAGVGSVMTAYNAVNGSACSQ
NSMLINGILKDELGFQGFVMSDWLSHMSGVGSALAGLDMNMPGDTQVPLFGYSYWMYDLT
RSVLNGSVPIDRLNDMATRIVAAWYHSGQDNDYPPPNFSTNTRDREGDLYSGAWPFSPRG
IVNEFVDVQADHYLVARKVAQDAITLLKNDASILPLAPNRSIKVFGTGAQTNPDGPNACP
DRKCNKGTLGQGWGSGTVEYPYFDSPIDALKKKATDVTFYNTDSFPNVPTPGSEDVAIVF
LTSDSGENTYTVEGNHGDRDGSGLYAWHGGDELVKKTAGKYESVVVVVHTVGPLILERWH
DLPSVKAILFAHLPGQEAGESLTNVLFGDVSPNGHLPYSIPKQESDYPSSISTLVKGSGV
ADDYTEGLFIDYRYLNKAGITPRYAFGHGLSYTTFSILEPTITKVAKLSSIPPTRPTKGN
ILDYSGPYPDESEALPPEGFHKIFRYIYSWLQPDEAKEAVKNRNTRTYDAYPAEYNTKQK
AGPRAGGAEGGNPALWDVAYKVSVTVKNSGAQHPGKAVVQAYIQFPDDIPYDTPIVQLRD
FAKTRTLNPGESQTLELQLTRKDISVWDVEIQDWVIPNVEGRFKLWIGEASDSLSIVCLT
DKLSCESNAKAPV

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	282	1e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.83e-53	71	433	57	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.65e-44	384	612	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	2.92e-43	71	828	101	751	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.88e-38	93	320	86	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	5.88e-22	33	662	51	664	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY63588.1|GH3	0.0	8	853	34	884
UQC82219.1|GH3	0.0	11	853	37	878
QYS94687.1|GH3	0.0	11	853	52	895
BAP59015.1|GH3	0.0	11	853	51	895
QUC22443.1|GH3	0.0	11	850	38	911

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IIB_A	3.80e-221	16	836	9	833	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
6SZ6_A	6.47e-221	17	839	8	834	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJJ_A	3.53e-219	16	836	10	834	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5FJI_A	2.14e-215	16	836	9	836	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5JU6_A	7.27e-214	16	836	28	847	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NP65|BGLF_ASPFN	0.0	6	839	29	858	Probable beta-glucosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglF PE=3 SV=1
sp|Q4WMU3|BGLF_ASPFU	0.0	11	838	39	860	Probable beta-glucosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglF PE=3 SV=2
sp|B0Y7Q8|BGLF_ASPFC	0.0	11	838	39	860	Probable beta-glucosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglF PE=3 SV=2
sp|Q5B6C6|BGLF_EMENI	0.0	16	838	40	859	Probable beta-glucosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglF PE=3 SV=2
sp|Q0CI67|BGLF_ASPTN	0.0	16	838	41	858	Probable beta-glucosidase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000001

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_004269-t41_1-p1.