CAZyme Information: jhhlp_004139-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_004139-t41_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720	NLAX01000010|CGC6	78116.33	4.3306

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000010:3245772-3248196(+)

Full Sequence      

MSSSSVKLALAALSLIQYVVAAPARADAAVVIKRQAELRDEYDFIVAGAGTAGLTVADRL
SESGEYKVLVVEYGYLDGSHSITATGPDAQQPGNVDYPSGTRMYNITSQPLVNLHGRGNP
VACGSVVGGSSAVNGMFFDRGSADDYDAWVRCAGDEADSYAREWGWDNIYPFFQKSVTFH
PPDERMQEEYGMTYDMAAYGGDTPIHSSYAPFQWPTTVGIWKAWETIEGVEFPKEHADGN
ATGVFWCPNSIDPSDRTRSYSRRGHYNNGANKRTNFHLLPGHRVTRVALEEVEGDENNSH
RATGIYIAPRDGPMWESGPVFIKAKKEIVVSAGSVHTPQVLQRSGIGHKDVLEAAGVEVK
VELPGVGFNLQDHSHYSISFNFTTNLSPNPNDLGTDADFTAEALEQWRENKSGPHSANVN
AGAFLPLSFVSNRSAEILEAWLAQDPAEFLPENAHPTVIAGYEQQRRVQAEMFESKKSAE
LEWLFSGRSSFSIITIKITSRGTILLSPEDDGDSQGHVEPLVDWRTWSNPIDGDMATEFL
KFARWFMASDAMQETFAPVEISPGPDVATDEEIRAWIQTRISPSNGHLIGTAALGPKSLG
GVVGPDLLVHGVQGLSVADNSIMTTIVGAHTSSSAYAIGEKAADTVLRRAKKNGDATEET
PVEETPVDDEDSCVPEPEGPVEESPVEEEPVEEAPVEEAPVEEAPVEEGPEKPAPPPQEP

Enzyme Prediction     

No EC number prediction in jhhlp_004139-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	41	647	8e-147	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.43e-74	41	650	5	535	choline dehydrogenase; Validated
225186	BetA	6.97e-65	41	651	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	4.01e-38	43	647	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	1.71e-28	499	642	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	5.23e-21	121	373	21	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD00954.1|AA3_2	2.52e-134	42	651	25	606
UQC73730.1|AA3_2	1.17e-133	31	650	35	647
AEO63808.1|AA3_2	7.25e-131	37	646	35	634
EGX43942.1|AA3_2|CBM1	4.19e-130	38	653	41	625
AEO58401.1|AA3_2	6.74e-129	38	650	43	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	1.41e-112	33	648	26	640	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	7.83e-96	38	654	2	590	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	4.86e-51	41	648	40	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	1.26e-47	41	646	1	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	6.07e-47	41	646	2	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	5.99e-87	41	646	37	613	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	4.61e-64	43	648	41	631	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.61e-59	42	647	47	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.61e-59	42	647	47	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	2.06e-53	42	648	41	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000851	0.999137	CS pos: 26-27. Pr: 0.4833

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_004139-t41_1-p1.