CAZyme Information: jhhlp_004131-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_004131-t41_1-p1
• CAZy Family: GH11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809	NLAX01000010|CGC16	86652.67	4.7262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000010:3225569-3228205(+)

Full Sequence      

MRLSTALFWAATVAVQGVAGFWLEDIAHQGKAPYHSDSDYQVFRNVKDFGAVGDGVTDDT
EAINKAISSGQRCAPQECKQSTTSPAVVYFPSGTYLVSGSIIDYYYTQIIGDPTNRPVLK
ASADFPTDTTLGIIDGNRYGADGLAWIAVNVFFRQIQNLIIDTTAIPASANAVGIHWPSS
QATALSNVEFRLSSESGTQHVGLLMEEGSGGLLNDLTFRGGSIGARLGNQQYTARNLQFF
GCETAISQLWDWGWTYKSLVVEDCKVGVDVVDNSTASLTILDSKFTRVGEAVKTKRDGDN
TNPKASGSLVLENVSFDKVTAILTGPKGVIIPGDSAGETLVEGYADGHLYDYKGPKVYTG
DDIKYFPRPSALLDGDKYYEKSKPTYGDVPASNFVSIRDFGASGNGVDDATSALNDLFAH
VAGTDKVAFIDAGYYVITDTVTIPAGVRVVGEALASILLGTGPVFSNMEKPVPVIRVGNP
GDRGRVEWSDMIVSTRGPTAGAKLIEWNLYSPGEPSGMWDVHVRIGGFAGTELQLAQCPT
TPTESNVINEDCIAAYLSLHVTKSAGGLYNENCWVWVADHDIEDPDYTQVTIFAGRGVLV
ESEKGRIFLSGSGSEHHVLYQYQFVNTRDVYMGQIQTETPYYQPNPPASVPFPPVTAIQD
PDFAKSCKGVPADVPCDMAWGLRIISSKDLVIFGAGLYSFFNNYSTDCCQPESGTECQQR
IFEVVGSSSVKKRGVCSGHGGGHGGNGGGHHGGNGTHPNPPTNGASTFSTYNLNTIGTVR
MVTRYGKDIALASDNTAGFVDTIAVYYNA

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	15	737	3.2e-256	0.9445945945945946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	6.77e-95	43	269	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.63e-04	394	508	1	122	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	1.92e-04	45	101	84	129	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC83812.1|GH55	0.0	5	806	4	785
QKD53170.1|GH55	6.04e-285	19	806	17	767
EAA35992.1|GH55	1.08e-284	1	807	1	835
QGI77988.1|GH55	3.10e-282	7	806	5	766
QGI60800.1|GH55	3.10e-282	7	806	5	766

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.46e-206	19	804	4	751	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.40e-180	21	730	26	717	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	4.37e-06	45	122	76	150	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	4.52e-207	10	734	37	750	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	7.90e-184	19	807	41	874	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	8.76e-56	27	737	47	725	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000209	0.999742	CS pos: 20-21. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_004131-t41_1-p1.