CAZyme Information: jhhlp_003913-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_003913-t41_1-p1
• CAZy Family: GH1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	NLAX01000010|CGC11	49833.93	9.8669

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000010:2241990-2243498(-)

Full Sequence      

MDRQQPPVYVRVYRLGMDIANGRHALSRLVAPLLWIFDMALCALVIWKVPYTEIDWVAYM
EQVKQFLDGERNYVRIEGGTGPLVYPAAHVYTYTALYRITNNGENILLAQQIFAGLYLAT
LALVMACYKKANAPPYILPLLVLSKRLHSVFMLRCFNDCFAAFFLWLAIFLLQRRLWTFG
TIAYSWGLGIKMSLLLALPAVAVILFLGRGFYGSLRLAMLMLETQIAVAIPFLMHDSRAY
LGRAFELTRQFKYEWTVNMRILSEETFLSKELAATLLVFHAADLFSFITGRWLAPTRQSL
WEIVPSLLRGKSPFTEKEEAAVSLGVSPRFVLTTILAAMNMGMLFARSLHYQFYAYLAWS
TPFLLWNAGLHPVIIYVVWAMQEWAWNVFPSTPASSAIVVFAMLFADRVTWMWGYRAGEK
PRMTAARDSAKPKQGR

Enzyme Prediction     

EC	2.4.1.258:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT58	31	396	1.8e-139	0.9972527472527473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398745	ALG3	0.0	32	396	1	358	ALG3 protein. The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate. Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man. ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96464.1|GT58	2.43e-188	1	400	7	406
QYT02043.1|GT58	3.29e-182	14	434	6	418
AEO60805.1|GT58	1.21e-181	1	430	15	443
AAK07848.1|GT58	8.57e-181	6	427	12	442
QLI63876.1|GT58	1.72e-180	1	427	1	429

PDB Hits     

jhhlp_003913-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C1K8|ALG3_NEUCR	1.52e-181	6	427	12	442	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=alg-3 PE=3 SV=1
sp|Q2U6A4|ALG3_ASPOR	7.27e-138	21	403	13	384	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=alg3 PE=3 SV=1
sp|A1CBE6|ALG3_ASPCL	1.13e-130	15	403	69	446	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=alg3 PE=3 SV=1
sp|Q4WVG2|ALG3_ASPFU	2.61e-129	21	403	21	392	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=alg3 PE=3 SV=1
sp|A1DDZ3|ALG3_NEOFI	2.21e-123	21	403	13	384	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=alg3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999983	0.000044

TMHMM  Annotations     

Start	End
25	47
106	128
150	172
185	207
212	234
320	342
357	379
384	406