CAZyme Information: jhhlp_003295-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_003295-t41_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518		58735.36	4.4940

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:6312967-6314730(-)

Full Sequence      

MSPSQQNLPLPLLSLLWVALGAAMLPTDCQRYDMTSGLSNSPLSEGKYALPYQRPEPRCR
TFNSTEVEETIEQMRKEIVDPDLFRLFENTFPNTLDTTISWKGFGSDDPNEELTFVRTGD
INAMWLRDSANQLQSYKSLLKRDSSPDSLASLFRGAINLQGRYIRESPYCNAFQPPEEAG
LGPEYNGWVTSDFVVPRFFRDFAFECKYELDSLAAFLQLSHDYYNQTEDVEFFKNSKWMD
TISVIMNTTTEMLTGTYASDGTINKSPYLFERKTNKASETMSNDGAGAPVKSNTGLIRSF
FRPSDDACAFQLFIPANMMFSSSLAACAEIMKEIDDEMGEMMSGFAGVIRAGVEEYGKFK
HPEFGEMYAYEVDGFGSRYLMDDANIPSLLSIPMLGYLDMKDPVYLNTRRFVLSTENPYF
MYGPVLNATGGPHIGPGMAWPMALIVQLLTSDNDYEIEVGIRQLLSSTDGLGLMHESIHS
HDQHRWTRSWFAWVNGLFGQVILDLRERKPHLLRLDYQ

Enzyme Prediction     

No EC number prediction in jhhlp_003295-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	80	503	4.3e-161	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	80	503	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	1.62e-153	59	516	2	433	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC90852.1|GH125	1.46e-227	12	518	45	552
QSZ30983.1|GH125	3.35e-208	28	518	27	518
UPK90974.1|GH125	1.18e-207	20	518	10	512
QGI65997.1|GH125	1.31e-207	28	518	17	512
QGI96878.1|GH125	1.31e-207	28	518	17	512

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ON6_A	7.52e-103	54	513	23	457	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	2.44e-102	54	513	43	477	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	3.16e-102	54	513	21	459	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	2.53e-82	61	504	2	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	1.11e-81	61	504	2	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.84e-144	29	514	27	505	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999752	CS pos: 29-30. Pr: 0.9587

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_003295-t41_1-p1.