CAZyme Information: jhhlp_003233-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_003233-t41_1-p1
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	NLAX01000008|CGC29	68072.72	4.5228

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:5970377-5972699(-)

Full Sequence      

MPPRRYLGLRAALVALLGVAGVYARPSQCKTRAVGDPQLLAPEEVEDEYDYIIVGGGTAG
LTVADRLTESGEHTVLVIELGFYDNSTSVRTIAGGAGAFANQSHLFSFTSAPQAGLNNRT
TAVIGGVMLGGSSGVNGLQVHRGHKDDYNRWAAYFGEEEEGESGWGWDGLLPYLKKAWHF
HPPNEDTAEALDIKYDASYWGDSADVHASFPTFNWPGLRLEMEAFAEIDGAEFPPDSGAG
SPGVYWYPTSADPSSMTRSFSRTGHYDGIARDNYKVLTGHRVLNVLFDDDSASGVRYVAK
GATNDTDARSVGARKEVILAAGTIHTPQILQGSGIGAKALLESADIEVKVDLPGVGWNFQ
DHPLGGGASFDVYPLPTELQSNASFREAAQAEFAESLSGPLTIASGNAACFLPLPVIAPE
AFEDIASRYESQDPAAYLPADSPATIVAGYGAQQKAMAAAMRSHGTAYYNLFLRGGGSEG
ALVFLHPVSRGTVYIDPSDPYFSEPVVDYRAMSNPADVDIEVEFVKFTRRYWTETSLSQY
NPVETRPGEEVQDDEDLRAYVRANVSPSTFHPVGTSAMMPRELGGVVDRELLVYGVKRLS
VVDASVIPDLPGAYTQHSVFAVAEKAADLIKARA

Enzyme Prediction     

No EC number prediction in jhhlp_003233-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	48	632	2.1e-159	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.83e-73	46	634	3	535	choline dehydrogenase; Validated
225186	BetA	1.81e-70	42	634	1	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.51e-32	487	626	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	2.75e-26	50	630	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	8.40e-18	117	363	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73730.1|AA3_2	6.38e-268	9	634	7	647
AEO58401.1|AA3_2	1.03e-241	48	634	46	635
VBB80399.1|AA3_2	4.87e-191	12	631	2	628
AEO63808.1|AA3_2	8.05e-187	40	631	31	635
CDP28753.1|AA3_2	2.24e-186	12	625	2	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	7.52e-108	9	630	4	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	5.49e-103	45	631	2	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	6.24e-62	48	630	40	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	1.08e-59	48	632	1	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.60e-59	48	632	2	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.48e-95	39	631	27	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.11e-75	49	630	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.11e-75	49	630	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	2.34e-74	1	631	1	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q3L245|PDH1_LEUMG	3.21e-61	48	630	40	597	Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris OX=201219 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.022351	0.977616	CS pos: 24-25. Pr: 0.9442

TMHMM  Annotations     

Start	End
7	24