CAZyme Information: jhhlp_003131-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_003131-t41_1-p1
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
143	NLAX01000008|CGC17	15591.50	6.4584

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:5562413-5562962(+)

Full Sequence      

MRCGRNGTLSGRGSDIATVVAGDVVGFKSSGKIGLDIYHPGPGLAYLSRSPEGVDVRDYD
GSGEWFKIEEIGLNLTYSDIPGNEGKVSWSLQGKYEFMMRIPKRTPQGQYLLRVEHIYPN
SGWNETQFYVNCAQVNVVGPGGG

Enzyme Prediction     

No EC number prediction in jhhlp_003131-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA9	1	141	2.1e-32	0.6181818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410622	LPMO_AA9	6.14e-31	1	143	43	177	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 9 (AA9). AA9 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs) involved in the cleavage of cellulose chains with oxidation of carbons C1 and/or C4 and C6. Activities include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54) and lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56). The family used to be called GH61 because weak endoglucanase activity had been demonstrated in some family members.
397484	Glyco_hydro_61	1.07e-26	1	143	45	181	Glycosyl hydrolase family 61. Although weak endoglucanase activity has been demonstrated in several members of this family, they lack the clustered conserved catalytic acidic amino acids present in most glycoside hydrolases. Many members of this family lack measurable cellulase activity on their own, but enhance the activity of other cellulolytic enzymes. They are therefore unlikely to be true glycoside hydrolases. The subsrate-binding surface of this family is a flat Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW08065.1|AA9	2.14e-30	1	143	59	193
QRV79179.1|AA9	2.14e-30	1	143	59	193
AEO69043.1|AA9	3.48e-30	3	143	74	205
CDP24614.1|AA9	1.58e-29	3	143	51	183
CAP67201.1|AA9	1.58e-29	3	143	51	183

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI8_A	6.94e-20	37	141	70	169	Lytic polysaccharide monooxygenase 9F from Neurospora crassa, NcLPMO9F [Neurospora crassa],4QI8_B Lytic polysaccharide monooxygenase 9F from Neurospora crassa, NcLPMO9F [Neurospora crassa]
3EII_A	1.31e-18	36	141	65	165	Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_B Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_C Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EII_D Zinc-bound glycoside hydrolase 61 E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_A Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_B Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_C Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris],3EJA_D Magnesium-bound glycoside hydrolase 61 isoform E from Thielavia terrestris [Thermothielavioides terrestris]
7EXK_A	3.20e-17	14	143	54	174	Chain A, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_B Chain B, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_C Chain C, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_D Chain D, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_E Chain E, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B],7EXK_F Chain F, Glycoside hydrolase family 61 protein [Gelatoporia subvermispora B]
4B5Q_A	2.59e-14	17	143	58	174	Chain A, GLYCOSIDE HYDROLASE FAMILY 61 PROTEIN D [Phanerodontia chrysosporium],4B5Q_B Chain B, GLYCOSIDE HYDROLASE FAMILY 61 PROTEIN D [Phanerodontia chrysosporium]
5FOH_A	7.72e-13	35	143	77	178	Crystal structure of the catalytic domain of NcLPMO9A [Neurospora crassa OR74A]

Swiss-Prot Hits     

jhhlp_003131-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000001

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_003131-t41_1-p1.