CAZyme Information: jhhlp_003116-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_003116-t41_1-p1
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	NLAX01000008|CGC13	23935.70	4.7348

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:5477768-5478624(+)

Full Sequence      

MVSFTAAVLLAAGTLASPLEHEARQANCPAIHIFGARETTVPPGMGTAGPIVQSIIQAHP
GATSEAIDYPACGGQGNCGGVQYGDSVKAGTAAAAKAINDFNARCPDTQLVLIGYSQGGQ
IFDNAFCGGGDSNSGISDTSIPISEAAQEMVKAAIFCGDPRHIAGLAYAVGTCQASGFAP
RPAGFVCPHEDKVQLYCDSTDPYCCNGNDANSHQQYGNKYGAQILEFVNARLT

Enzyme Prediction     

EC	3.1.1.72:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	27	232	6.2e-42	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	6.96e-54	28	232	2	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA13322.1|CBM1|CE5	4.65e-103	7	233	9	236
ATZ57431.1|CE5	5.62e-102	8	233	12	236
EGX46772.1|CBM1|CE5	9.48e-102	4	233	3	231
CCD50589.1|CBM1|CE5	3.97e-101	8	233	12	236
QYT05414.1|CBM1|CE5	6.94e-100	14	233	18	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QOZ_A	1.29e-96	28	233	2	207	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
1BS9_A	3.85e-91	27	232	1	206	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	7.75e-91	28	232	2	206	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	1.81e-89	27	232	1	206	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q99034|AXE1_HYPJE	5.60e-95	2	233	4	238	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|O59893|AXE2_TALPU	2.74e-94	4	232	5	233	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	2.94e-93	5	233	3	230	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|C8VJF5|CUTI4_EMENI	2.18e-08	27	225	59	217	Cutinase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cut4 PE=2 SV=1
sp|Q00298|CUTI_BOTFU	9.91e-07	7	125	11	126	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000310	0.999668	CS pos: 24-25. Pr: 0.9447

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_003116-t41_1-p1.