CAZyme Information: jhhlp_003108-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_003108-t41_1-p1
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448		47861.88	9.8118

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:5452731-5454196(+)

Full Sequence      

MTKPGQVRSSDTSTLVKSFIAWKLFLLAIALGSSTTPSYDTSTSLALNLPPDHVAPSAFP
ASSSSLTDILAARLTRWDAIYFTQSASRGYVFEQEWAFGYGMPFVVSKVVLPLASRLGLP
SPVTVKSAALGAIAVSHLSHLATVLVLYSLVHRLFPDSGRLALTTGLLHVLSPAGLFLSA
PYAESLFAFLSFAGYNIYVSSASVPSENPTILRGLGLILSGALLGLATACRTNGMLNGII
FVVELFAALHVFVRSPRLTHALAVVPPTVGGALVGLGSVVPQAAAYLRYCSDASGTGGLR
PWCTKLVPSIYNFVQEHYWNTGFLRYWTPGNIPLFFLAFPMLALMFTSSYKTAVPLVPAL
SSLGSTPPSNRLLLSLSLGQGLLALLALFSYHVQISTRLASAYPIWYVWVAQSLSSRSSG
DLPRNVVMYMVLYAAIQGVLFASFLPPA

Enzyme Prediction     

No EC number prediction in jhhlp_003108-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	16	448	5.8e-107	0.995085995085995

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.30e-33	39	448	27	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	1.17e-16	76	448	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73372.1|GT76	1.29e-118	9	448	7	437
UKZ62611.1|GT76	5.46e-111	8	448	7	433
QLI68133.1|GT76	1.92e-110	9	448	7	429
QPH11053.1|GT76	2.70e-108	9	448	7	432
CCT64606.1|GT76	1.31e-107	9	448	8	427

PDB Hits     

jhhlp_003108-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	1.47e-105	8	448	7	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	6.40e-105	5	448	12	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	1.51e-83	14	448	21	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	7.75e-75	39	448	56	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	2.22e-53	13	448	5	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.044592	0.955392	CS pos: 32-33. Pr: 0.9120

TMHMM  Annotations     

Start	End
96	118
133	155
168	190
210	227
234	253
258	280
334	356
371	393
426	445