CAZyme Information: jhhlp_003101-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_003101-t41_1-p1
• CAZy Family: CE2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
931		101567.62	6.9917

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:5412802-5416119(-)

Full Sequence      

MANITDLAMDPLWQDLDRVIGQLFIMGWDGTEVTPQIRSLIQDFHIGSIILTAKNLKNAQ
ETAKLVQELQTLAKEAGHRHPLLIALDQENGGVNSLFDEDYICQFPSQMGVAAAGRPELA
YEVSKATATEIAACGINLVLGPVLDVLSNTRDQPIACRATSDDPQEVSQYGIMAMNGIKD
AGAGSCGKHFPTYGSLDFRGSSVDMPVITQTLEELSLSALVPFRDAIASGNLDAVFVGGC
RISNPSMNVQHACLSDQVVDDLLRNEMGFQGVAISECLEMESLSHEIGVQNGVVMGVEAG
CDLILLCRAYDVQLEAIRGLKLGIDNGIVTRQRLFTSLERVQRLKVKCTSWAKALNPPGI
SLLSKLHPTHSALSRHAYDDSIVVVRDKEKLIPLSTSMRQEEELLLLTPLVKPLPATKLT
KTLLESKSSQGSAPTNHDKWVHRDRGTAILSGEEVFRELGRSLARARHGKLLHTSYTANG
VRPVHENLINRASAVIIVTADAKRNLYQAGFTKHVDMMCSILRSRGQKKNLIVVSVSSPY
DFALDKSISTYLCTFDYTENAMHALVRALCGETTPRGTLPGTMRRSRKSIKSKQYWLVEE
YNAVRDESALDELIRSVALASAPDHPYLKTSSAASFELTNPRVAEAHFVVRNSSTGALYG
FVATYRLGSTGIIGAIFVDPQKRGLSVGRSLHRRAMRSLLQARNVKKVQLGTVFPGVFLG
IPVDEGSAVKDWFASSGWDVQFPRRLTNLVINNLEAWTAPEGLLQSIQRANISFDLIHGI
ENADTVLSHVASQSNPEVVELYREALSKSCGVVRAKDPHDHLLGTIIICKEGNPLSTFIP
PLLSPAAEVVGGILAPVVPPSSQGTLILQGLALMGVRQIKSQKKASVAMLSWILDDMYDP
LKAMGFETLQVFEEITNSPDNVSSFLKQIAL

Enzyme Prediction     

No EC number prediction in jhhlp_003101-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	305	1.9e-46	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	4.56e-61	20	397	7	353	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.51e-52	16	344	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	4.52e-34	30	321	10	294	beta-hexosaminidase; Provisional
185053	PRK15098	2.84e-11	16	276	47	287	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73624.1|GH3	0.0	1	921	103	1023
UPK90842.1|GH3	0.0	1	924	60	986
QLI67752.1|GH3	0.0	9	920	22	935
QUC21106.1|GH3	0.0	9	920	22	935
UNI22598.1|GH3	0.0	6	920	8	924

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	4.23e-85	15	777	8	716	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.71e-58	16	583	13	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.49e-38	31	580	71	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.43e-38	31	580	45	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.71e-38	31	580	75	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.28e-37	31	580	71	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	1.82e-32	30	334	12	308	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	1.91e-30	23	323	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
sp|B4SRK3|NAGZ_STRM5	4.73e-30	23	323	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|P48823|HEXA_PSEO7	9.14e-30	31	401	49	441	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_003101-t41_1-p1.