CAZyme Information: jhhlp_003086-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_003086-t41_1-p1
• CAZy Family: CE15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	NLAX01000008|CGC11	36339.37	7.9443

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:5346322-5347407(-)

Full Sequence      

MYIRKKGRRMKLLTVASLMATALAASRTRAPSGCLVVRKEGGSDFYSTVQSAVDALSTSD
TAAQCIFIQPGTYTEQVLVTSRKAPLSIYGHTEDDTSYGSNTVTLVHSASQASTGGSNDE
TATLRVKAPNFRLYNVNVENSYGKGSQAVAVSAYADSGYYGCSMKGFQDTLLSNDGKQVY
ARSLIQGATDFVFGQRARAWFETCDIKVVENSVGYITANGRDSESNVSFYVFNSSSIAAA
SGHNVANGAYYLGRPWRDHARVVFQHTSMSSVINSAGWREWGSSDPKTCCVLFGEYGNTG
PGASGQRASFSTKLSTPIQIAEILGDGFETAGFFDAAYL

Enzyme Prediction     

No EC number prediction in jhhlp_003086-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	36	315	2.2e-77	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	7.95e-49	24	315	2	273	putative pectinesterase
178372	PLN02773	5.28e-47	30	314	2	282	pectinesterase
215357	PLN02665	7.56e-47	37	315	72	341	pectinesterase family protein
215367	PLN02682	4.95e-46	24	315	60	348	pectinesterase family protein
395871	Pectinesterase	4.47e-43	36	311	3	275	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI88211.1|CE8	7.42e-144	10	339	1	329
QGJ01763.1|CE8	7.42e-144	10	339	1	329
CCT75603.1|CE8	7.42e-144	10	339	1	329
QGI70873.1|CE8	7.42e-144	10	339	1	329
QKD62636.1|CE8	3.01e-143	10	339	1	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	3.41e-69	26	326	2	289	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	4.82e-69	26	326	2	289	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.34e-28	35	304	9	274	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.76e-27	36	303	6	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	7.06e-11	35	326	7	336	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	2.93e-107	13	338	6	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	9.56e-106	20	339	13	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q5B7U0|PMEA_EMENI	7.60e-71	13	325	7	314	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.33e-69	25	330	26	318	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.33e-69	25	330	26	318	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.027591	0.972370	CS pos: 24-25. Pr: 0.9169

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_003086-t41_1-p1.