CAZyme Information: jhhlp_003018-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_003018-t41_1-p1
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		26652.81	5.6774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:5080694-5081660(-)

Full Sequence      

MVFRHLIVALLASVAASQSRLAKTYTGWNWYVICVYFGPILTWNRGYKLTSRQYRGAINV
CDKNNNRLDREAGRTSQSTCEGATSDTGFLCADYSPIPISEDLSYGFAFHIGNDFTAENP
NCCKCFEVQWVSGAAGDKNKRMVVQVVSPGGAGGDVVAGDLIIMTPGGGLGPVGSACRAQ
HGSGYDWGDDYGGITDGPNCDRIPSDLQGGCYWRFNWAGGNINGWEAVYNQVACPSRLTD
ISGCAVNP

Enzyme Prediction     

EC	3.2.1.4:43	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	53	244	8.7e-39	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	1.00e-27	58	244	27	213	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84601.1|GH45	7.05e-69	22	244	26	243
CAJ75963.1|GH45	8.97e-51	56	244	49	220
CAC94522.1|GH45	8.97e-51	56	244	49	220
QYY49566.1|GH45	1.26e-44	89	244	83	228
QRV85206.1|GH45	7.85e-38	56	244	48	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	5.69e-26	60	247	53	224	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
1HD5_A	6.48e-24	76	247	43	202	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]
1L8F_A	1.11e-23	61	244	31	198	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]
1OA7_A	1.30e-23	61	244	31	198	Structure of Melanocarpus albomyces endoglucanase in complex with cellobiose [Melanocarpus albomyces],1OA9_A Structure of Melanocarpus albomyces endoglucanase [Melanocarpus albomyces]
2ENG_A	2.32e-23	76	247	43	202	Endoglucanase V [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	1.06e-26	55	244	40	219	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	1.28e-22	76	247	43	202	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|P54424|GUN1_USTMA	1.35e-20	68	244	63	234	Endoglucanase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EGL1 PE=2 SV=1
sp|O97401|GUN_PHACE	2.46e-17	77	246	83	242	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.677589	0.322410

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_003018-t41_1-p1.