CAZyme Information: jhhlp_003013-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_003013-t41_1-p1
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	NLAX01000008|CGC28	40333.30	4.4471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:5062371-5063625(+)

Full Sequence      

MHLSTLALPLLAASLPGANAQLNKLAKKAGLKYFGAATDTPGQRERAGFEAAYDQYDAIL
NDIDEFGQTTPTNGQKWLFVEPEQGVFNFTEGDIVAGIAKENGQLLRCHTLVWHSQLAPW
VEEGEWTADELREIIVNHITEVAGHYKGQCYAWDVVNEALNEDGTYRESVFYNVLGEEFI
KLAFQTASEVDPDAKLYYNDYNLESVSPKSKAAVGIVKMLQAEGIKIDGIGMQAHLIAHQ
APSLEDQLAVIASYAATGVEVAYTELDVRLETPANATNLEWQSNVYRDSVAACVQSEACV
GLTLWDFYDPFSWVPFVFEGEGAALLWFEDFSTHPAYDAVVDVLKKGAAPGGGSCKSKKS
KRSKKLF

Enzyme Prediction     

EC	3.2.1.8:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	22	342	1.5e-93	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	7.28e-124	22	342	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	6.54e-106	76	340	2	263	Glycosyl hydrolase family 10.
226217	XynA	1.64e-73	65	348	57	345	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC74857.1|GH10	2.13e-197	1	367	1	367
QBZ59911.1|GH10	2.91e-175	5	364	4	354
AHE13927.1|GH10	5.11e-171	22	360	28	366
ASL68670.1|GH10|3.2.1.8	9.98e-170	2	367	4	364
AGG68962.1|GH10|3.2.1.8	4.07e-169	22	363	34	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	1.49e-122	20	341	1	314	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	1.66e-109	22	341	25	336	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	2.97e-95	20	344	3	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3U7B_A	7.52e-94	27	344	10	324	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
3WUB_A	9.59e-94	20	344	3	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	6.22e-109	18	348	17	338	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|P79046|XYN1_HUMGT	4.54e-106	4	344	5	337	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|Q9HEZ1|XYNA_PHACH	1.26e-100	20	340	92	402	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	5.42e-100	16	340	78	393	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|O60206|XLNA_AGABI	1.22e-98	10	342	7	329	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000350	0.999616	CS pos: 20-21. Pr: 0.9730

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_003013-t41_1-p1.