CAZyme Information: jhhlp_002964-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002964-t41_1-p1
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
733	NLAX01000008|CGC14	79952.44	4.1816

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:4855070-4857533(-)

Full Sequence      

MAPSSSKVMSLRGLLARALVSASILGVAVARPAHARSALVRRQEEIYDEYDYIVVGAGTA
GLTVADRLSEDGKYTVLCIEYGYLDSSTSITTVGPGSRRDEYPSATRYYNITSIPQPGLA
NGRKAAMAGAVVGGSSAVNGMFFDRGSAEDYDIWVRAAGEWSDAFAEEWGWDNILPYFKK
SVTFHPPSEEMAEQYGMTADVEAAYGGSTPIHSSYAPYQWDVQQHIWEGFKHIDGVEFPV
EGADGHAVGVFWCPNSIDPSTRTRSYSKIGHYDTEDGPAYRQNFHLLTGHRVTQVLLEEA
EDDGGDIVWDATGVLFTPRDGPMPETAWRVKARKEVVVSAGALHSPQVLERSGIGPQDIL
EAAGVIPKVVLPGVGWNFQDHPNWGMSFRWTKEDLGPTPETFNADEEFLAWADELWAANK
TGPHSAYVNSGAFLPLSVLTEDYRSIVETIAAQKAEDYLPEGLDRTIYAGYQQQLQILAQ
TYNSTGTAILELPFSGRSGFSLVNLHELSRGSVHISPDDDGTTDTGRGDMEPVVDYRTLV
NPVDNQVNAVMVAFVRRFFASESLVESLAPEEVSPGVEEYPDGSEELDGWLRRVLTPSTG
HPVGTCSLAPLELGGVVGPDLTVYGTRRLSIADNSIMPLIPGTHTSSTAYAIGEKAADLV
KRRTGWFDESSGEEPTPEEPADPEEPAQPEEPAEPEDPDDEFHILPIEEPAEPAEPEDPL
PEDPDITPEEPRK

Enzyme Prediction     

No EC number prediction in jhhlp_002964-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	49	662	2.1e-144	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	6.32e-65	49	664	5	535	choline dehydrogenase; Validated
225186	BetA	5.45e-59	49	665	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	6.94e-43	51	660	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	7.87e-28	118	382	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.69e-24	509	656	3	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD00954.1|AA3_2	5.36e-150	50	666	25	607
VBB80399.1|AA3_2	9.84e-149	45	661	34	628
AEO63808.1|AA3_2	1.66e-146	45	661	35	635
AEO58401.1|AA3_2	5.54e-145	24	663	18	634
UQC73730.1|AA3_2	3.51e-143	35	663	31	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	1.36e-117	13	668	2	644	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	2.70e-90	46	662	2	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4H7U_A	2.47e-52	19	662	12	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
4YNT_A	6.41e-51	50	661	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	1.39e-44	50	661	17	588	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.23e-92	39	667	27	620	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.11e-77	51	662	41	631	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.20e-65	50	660	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.20e-65	50	660	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	6.08e-64	38	666	2	614	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.842406	0.157587

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002964-t41_1-p1.