CAZyme Information: jhhlp_002777-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002777-t41_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617	NLAX01000008|CGC32	67213.10	6.1633

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:3991636-3994008(-)

Full Sequence      

MRLLKTFSIGACVLGVVEALPRRVSDFSKRQVTQLRDEYDFVIIGAGTAGLTVADRVSAA
FPHRTVLVIEYGKIEQSVGYYDPPEDGKGVSRLVISSPPVESVNNRSATVILGMTVGGSS
AANGQFFDRGSKYDYDEWARLGLPEFRGGEKWDWKHLYPSFQKSSFLTEPSAELAAEFGY
TWDSSNYGGDSIQASFPPFQWPIQSISWKAFEEFGLETPKDCADGNKHGLCWVPTAQNSE
TVERSHAGVGHYTNIAASRPNLDLLVEHKVTRLVVDKTKKVPAVEFRPVAGGDVKTIRPK
REVILSAGAIHTPQILQRSGVASAEYLKSVGIELVEDLPGVGQNFQDHCGPPITFSYDTP
HPSEADVTNNATFAAEAVAQFRERPARGPYTLAMGNSAAYVSLPKITSEYKQIVAKIRKQ
IKDRSALQYLPEGASKSVQKGYLAQLEVIAQALENPEHPILEAPFATGPATAFLLKPLSR
GTVLLNPEDHDATPIVNYRTAANPIDLDIMVTYVDYFRRLYATDTWQSLNAVEVAPGAEV
TDHSELVEFIKNSIIQSLMHPCCTAAMLPREKGGVVNSSLAVYGISGLRVADCSIIPTLP
AAHTTTTAYAIGEKASC

Enzyme Prediction     

No EC number prediction in jhhlp_002777-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	38	616	1.1e-150	0.9859154929577465

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.42e-66	38	615	7	529	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.35e-57	38	616	5	528	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.64e-26	477	615	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.98e-25	102	348	13	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.28e-08	22	600	35	557	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO67447.1|AA3_2	2.35e-189	14	616	11	633
VBB84441.1|AA3_2	4.34e-182	29	616	29	626
CDP31201.1|AA3_2	1.91e-173	29	616	29	626
QRD01783.1|AA3_2	3.93e-142	127	616	3	500
EGX43942.1|AA3_2|CBM1	7.57e-134	13	616	17	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	5.48e-195	9	616	9	635	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.13e-104	35	614	2	577	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	3.58e-49	38	614	1	556	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.79e-48	38	614	2	557	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	4.70e-44	39	616	6	561	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.39e-86	20	616	21	610	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	1.61e-61	11	616	13	612	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.61e-61	11	616	13	612	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.48e-53	39	614	41	602	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	3.48e-50	39	613	46	587	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.321452	0.678541	CS pos: 19-20. Pr: 0.6267

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002777-t41_1-p1.