CAZyme Information: jhhlp_002767-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002767-t41_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728	NLAX01000008|CGC19	81667.21	6.6010

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:3954099-3956399(-)

Full Sequence      

MASNKLIKANIVSDGKSFALNSEKISYRFHADESSGDLVSDHFGGIATEDVQLANIEVNG
WAEMPVRIRREYPDLGRGDFRIPAIRIRQSVGHAISDLRYESHKVVDGKPALPGLPSTFG
DEKSVSTLIVRLEDTHSSVSVDLSYSIFPKHDAVVRSAKITNNGDREITIENLSSFSVDF
PPQELEMIGLRGEWSREAATERRKIHYGTQGFGSATGYSSHLHNPFLAIVTPTTTESQGD
AWGFSLVYTGSFAVNVEKGSQGFTRAVIGFNPYHLSWPLAAGESLVTPECIAVYSASGIG
HMSRRFHRFFREHLIRPAYVNRPRPVLLNSWEGLSFNFDEEAIYKLAQDSAALGVKLFVL
DDGWFGVKHPRLADNAGLGDWEANPDRFPEGIGHLVDRVQKLQVANTDQKLKFGLWFEPE
MVNPRSSLYEKHPDWVLHAEDYPRTEARSQLVLNLSLLEVQDFVIESVSKILGSTAISYV
KWDNNRGMHEISHPSVAHKYILGMYRVFDTLTKRFPKVLWEGCASGGGRFDPGILHYFDQ
VWTSDNTDAAERVYIQFGTSLVYPPSTMGAHISAVPNWSTKRWTSIVFRGHVAMMGGSFG
LELTPAEMPEEERAKVPELIALSEKINPIIINGDLWRLNNPQDSNWPAALFLSQDRQRGV
LFYFQLRAHIHHAFPFVKLQGLDPEARYKVTCSNNGEATYSGATLMNVGLQYIFHGDYQS
RVVFIDRL

Enzyme Prediction     

EC	3.2.1.22:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	18	711	1.4e-236	0.9956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
307952	Melibiase	0.0	284	633	1	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
225882	GalA	1.36e-161	68	722	55	681	Alpha-galactosidase [Carbohydrate transport and metabolism].
269892	GH36	4.26e-124	323	622	1	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
407116	Glyco_hydro_36N	4.83e-98	36	280	1	256	Glycosyl hydrolase family 36 N-terminal domain. This domain is found at the N-terminus of many family 36 glycoside hydrolases. It has a beta-supersandwich fold.
407115	Glyco_hydro_36C	1.85e-26	646	725	1	78	Glycosyl hydrolase family 36 C-terminal domain. This domain is found at the C-terminus of many family 36 glycoside hydrolases. It has a beta-sandwich structure with a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC85830.1|GH36	0.0	9	728	29	744
QMW36232.1|GH36	0.0	11	727	36	750
QRD92785.1|GH36	0.0	11	727	36	750
CAA93245.1|GH36|3.2.1.22	0.0	15	727	34	744
BAE66504.1|GH36	0.0	11	727	36	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JHP_A	0.0	11	727	45	757	Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_B Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_C Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],6JHP_D Crystal structure of the glycoside hydrolase family 36 alpha-galactosidase from Paecilomyces thermophila [Paecilomyces sp. 'thermophila']
4FNQ_A	8.15e-188	70	720	74	719	Crystal structure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	2.30e-187	70	710	74	708	Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNU_A	5.18e-186	70	710	74	708	Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus],4FNU_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D478A from Geobacillus stearothermophilus in complex with stachyose [Geobacillus stearothermophilus]
4FNT_A	7.33e-186	70	710	74	708	Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_B Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_C Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus],4FNT_D Crystal structure of GH36 alpha-galactosidase AgaA A355E D548N from Geobacillus stearothermophilus in complex with raffinose [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARP5|AGALG_EMENI	0.0	15	727	17	725	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
sp|B8NWY6|AGALC_ASPFN	0.0	11	727	36	750	Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aglC PE=3 SV=2
sp|Q0CVH2|AGALC_ASPTN	0.0	11	728	33	747	Probable alpha-galactosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglC PE=3 SV=1
sp|Q2TW69|AGALC_ASPOR	0.0	11	727	36	750	Probable alpha-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=aglC PE=3 SV=1
sp|Q92457|AGAL2_HYPJE	0.0	15	727	34	744	Alpha-galactosidase 2 OS=Hypocrea jecorina OX=51453 GN=agl2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002767-t41_1-p1.