CAZyme Information: jhhlp_002734-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002734-t41_1-p1
• CAZy Family: CBM21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		36333.06	3.8894

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:3866809-3868088(+)

Full Sequence      

MRVSSIAGALWLAAGAAASNCASKNWAGWENAKYAFIFGDSYTQTGFDVTGEAPSASNPM
GNPPYPGWTSSNGPNWVGFLTNKYNATAALRTYNLAYGGATVDSDLVEPWQPTVLSLRDQ
VTDLFLPNYAPGSANAPDWDPKSTVFGIWIGINDVGNSFWSGEDATTELYGQIFDVYASL
VNDLYTAGGRNFVFLNVPPVQRSPLILDQGEQAIELETAALDKFNALIDGLAKDLKTAHE
KEVNVWVYDSYKSFGEVLDDVTAYPQTADYKDTTTFCEAYQNGTPEWDTLDENCTYPVNE
YFWLNSLHPTYPIHDVVAEGVAELLSGPPNVSA

Enzyme Prediction     

No EC number prediction in jhhlp_002734-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	37	321	2.5e-77	0.9850187265917603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	3.29e-64	36	323	3	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	2.95e-13	36	310	4	300	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	1.39e-11	20	328	12	336	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
395531	Lipase_GDSL	2.45e-09	36	272	2	208	GDSL-like Lipase/Acylhydrolase.
238872	SGNH_hydrolase_like_2	1.82e-05	90	233	34	144	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ46260.1|CE16	4.59e-107	22	331	34	340
QRC99106.1|CE16	1.02e-106	17	326	17	322
CBY01773.1|CE16	3.78e-106	25	330	29	330
CAE7178865.1|CE16	4.25e-106	15	325	15	322
APA06788.1|CE16	3.94e-103	22	331	34	340

PDB Hits     

jhhlp_002734-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	3.54e-64	31	327	30	299	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	1.11e-62	31	327	30	299	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000383	0.999601	CS pos: 18-19. Pr: 0.9656

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002734-t41_1-p1.