CAZyme Information: jhhlp_002699-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002699-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667	NLAX01000008|CGC33	72379.94	4.2999

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:3720010-3722441(+)

Full Sequence      

MSRLGAWRRALAPLALFSWASSVAAHPLVSDHLLKRAEIQIEDVRDNYDYVIVGGGQAGI
VLASRLSEDPDVTVLVVEYGYFNNAPSVLQPSSATSYQRNVQFNITSVPQTELDGYKQSV
FAACCVGGGSTINGMLLNRGSAADYDSWEALGNPGWGWEGLYPYFVKSQTLDEPSPAAVE
EFNITWGAESYGDGPIHVSFSSFQWPGIKVQRQALIEAGAEAPLDGSGGDSHGVIWYPTA
LNNATATRSYAVNGYWDPAKERPGLDLLTGWRVDEVTFNEDKHATGIIIRQRGVEDAERI
PIKSNREVILSAGALHSPQVLQRSGIGPKWLLDEAGIDVLVDLPGVGSNLQDHAVAGVSY
RFTTNLELNPQDSMANATFAQWAARELAENHAGPLRIATGNIGGLIPFPVIDPEGYEALI
EEYLSLELAQHLPSTYTEENVAGYDAQRTVMADMLGRRDNAFLELPLQAAPGYSAVLIKV
LSRGTVHLDPADIYAEPIVDYFTYGMPTDKRIMRSIIKWVRKVHETEAMSELGPEEVAPG
VDVVTDEEIDAWLTKSTSCSTAHNSCTNPMMPKEHGGVVGPDLLVHGVTGLSVADSSIMP
IVPGAHICSTVYAIAEKYKAADLIKERHGGKSGEPEEPAEECPAEEEKPEEPVEEEPIEE
EPEKGDD

Enzyme Prediction     

No EC number prediction in jhhlp_002699-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	47	626	3.8e-159	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.03e-97	48	627	6	534	choline dehydrogenase; Validated
225186	BetA	1.32e-80	47	629	7	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	9.34e-32	126	355	27	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.89e-29	482	617	3	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.85e-13	48	633	56	586	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGX43942.1|AA3_2|CBM1	3.27e-191	1	629	4	623
QRD00954.1|AA3_2	6.05e-155	48	627	25	604
SMY23609.1|AA3_2	1.10e-137	43	628	39	622
SMR50915.1|AA3_2	1.10e-137	43	628	39	622
SMR51855.1|AA3_2	1.10e-137	43	628	39	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	8.21e-122	16	624	8	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	8.39e-109	43	628	1	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	2.46e-65	48	626	6	566	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	9.43e-57	47	625	40	599	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3LJP_A	3.55e-52	41	632	6	534	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.66e-108	29	629	21	618	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	2.48e-70	16	624	4	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.48e-70	16	624	4	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.84e-67	49	626	41	631	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	1.68e-57	44	624	1	530	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.176472	0.823496	CS pos: 25-26. Pr: 0.7718

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002699-t41_1-p1.