CAZyme Information: jhhlp_002674-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002674-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	NLAX01000008|CGC33	33584.73	4.2689

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:3621870-3622802(-)

Full Sequence      

MNSFRKTLSTFLLTAPLILSASATPSPGCGTSHTLTDGRQVVTVNGRERQFILKLPENYD
HCHPYRLIFTFHPLGGSAEQIANGDANTLPWYGLPPISDNSAIFVSPNGTIGFMDLLGWG
NTDGDDVDFVDAMLDAIESDLCVNEDLRFSTGFSAGGAMSYAIGCARAEQFRALGIISGG
NMSGCEGGVPTKPIATYQQHGTRDEVRTDLKKAKANDEILTCIMKWQVLPFEGVLPVRDA
LVEANGCTPVTPEPEPNGSTAARVDYEGCLEGYPMTWVAFNGTHIPGYIDEGDDLPLATK
DIWEFFTQFE

Enzyme Prediction     

No EC number prediction in jhhlp_002674-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	45	188	1.4e-19	0.6035242290748899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	3.30e-13	14	308	10	306	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	1.79e-05	40	180	369	506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
223477	YpfH	0.006	67	216	20	178	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP24862.1|CBM1|CE0	8.78e-94	12	310	8	279
CAP67448.1|CBM1|CE0	8.78e-94	12	310	8	279
VBB74107.1|CBM1|CE0	1.24e-93	26	310	22	279
AKH85743.1|CBM13|CE0	2.01e-70	28	310	197	457
EGX54170.1|CBM1|CE0	2.05e-70	26	309	94	355

PDB Hits     

jhhlp_002674-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7RWX8|FAED_NEUCR	2.26e-73	1	309	1	289	Feruloyl esterase D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=faeD-3.544 PE=1 SV=1
sp|A2QYU7|FAEC_ASPNC	5.89e-63	12	306	10	267	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|Q0CDX2|FAEC_ASPTN	2.35e-62	8	307	4	268	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1
sp|Q5B2G3|FAEC_EMENI	6.63e-62	26	306	24	267	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|A1C9D4|FAEC1_ASPCL	1.12e-60	8	306	2	269	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000553	0.999433	CS pos: 23-24. Pr: 0.9412

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002674-t41_1-p1.