CAZyme Information: jhhlp_002453-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002453-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228		24571.40	4.3484

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:2730939-2731854(+)

Full Sequence      

MQAITVFLAAAVAFLPSVSAERGRTLTNWDCCKPACAWKSLLQQGVSGQVMVCNKDDQPY
SNDLSNSVPSSCGETSGNNQGYLCSDYQPRPVAENLAYGFAITDGIENCCKCFELQWTEG
PAAGKRMQVQVINEGGTVTDGKRDFILLTPGGGVGPNAQGCESQFGLDWGRQWGGVSQAS
DCESIPQNMQAGCYWRWNWARGDVNTWGVEYQQISCPEALTGISGCHA

Enzyme Prediction     

EC	3.2.1.4:43	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	26	226	6.1e-49	0.9747474747474747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	4.77e-42	29	226	8	213	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ75963.1|GH45	7.14e-66	1	227	1	221
CAC94522.1|GH45	7.14e-66	1	227	1	221
QYY49566.1|GH45	6.44e-59	17	227	23	229
VBB84601.1|GH45	5.48e-55	24	228	27	245
ADV02789.1|GH45	4.43e-52	15	226	13	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GLY_A	7.32e-43	23	226	5	200	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	8.20e-43	23	226	8	203	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
6MVI_A	1.55e-42	8	226	11	221	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5H4U_A	4.72e-39	4	226	3	219	Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_B Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_C Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus]
1HD5_A	8.14e-39	23	226	3	199	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	1.39e-45	8	226	7	219	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|D3GDK4|GUN_CRYAT	2.07e-38	4	226	3	219	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|P43316|GUN5_HUMIN	5.91e-38	23	226	3	199	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|O97401|GUN_PHACE	8.64e-35	23	226	40	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P54424|GUN1_USTMA	9.78e-24	23	226	27	234	Endoglucanase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EGL1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999790	CS pos: 20-21. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002453-t41_1-p1.