CAZyme Information: jhhlp_002445-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002445-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	NLAX01000008|CGC16	69565.08	4.3363

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:2700042-2702054(+)

Full Sequence      

MPSLKNTVLVFLTATAQLVAAWPTTSKYAQLVSRADEIADEYDYVIVGGGTSGLTVGDRL
TESGKYTVLVIEEGVFHDVTGFAPERMYDITSQPSPALNDRTFMVGIGKGVGGSSLVNGQ
VWLRGTTEEYDAWKTLGGSNAADWDWDGLLPYFKKAMTLNPPTEEQIEKYKILYDLDYWG
DGEIQVSFSNGTASEQTMILYEAMSKVDGMTIPADSGAGEAGLYWYPMAQDNVNYVRSYA
RTGHWDDINRENYQMITGSKVSNIIFGDDLTATGVTFRASNDTSAITVKAKREVILAAGA
IHTPQILMLSGVGPADHLAEAGIEARVDLPGVGSNFQDHSYIPFIGYTWGIPPNDEEPYY
GPGSGPDAHPNLAAMMGLPVITPDRYQEIAAKYAAQEPTEFLPAHYTEEQIEGYRQQQAV
FSKLMESSNVVFNEMMLSGPGGSVQNLHPCSRGDIRLNVSSPESEVLVDYRAGSNPLDLE
IMVEIVKFMRRFMTTGDLEQYQAIESAPGPDVETDEQLLEWVKNNIIPSVFHPIGTTAKM
PREWGGVVDEDLFVYGTKNLRIIDSGIQPTLIGATTCETVYAVAEKIAERILEQAGSDGG
ENPQEPEEPEEPEQPPKCKRALKRALKAKKSQKH

Enzyme Prediction     

No EC number prediction in jhhlp_002445-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	41	593	1.2e-142	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.35e-81	41	592	5	532	choline dehydrogenase; Validated
225186	BetA	1.32e-80	35	596	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	6.41e-38	43	589	2	484	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	3.52e-29	96	339	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	3.64e-27	449	587	1	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB71339.1|AA3_2	1.34e-163	38	587	23	582
CDP22349.1|AA3_2	1.31e-158	38	587	23	573
VBB78527.1|AA3_2	2.45e-152	31	595	25	617
AEO58401.1|AA3_2	2.80e-142	20	595	23	635
CDP28753.1|AA3_2	9.91e-142	37	587	34	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	1.37e-99	34	594	28	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	8.91e-78	38	594	2	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	1.28e-64	42	597	6	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6XUT_A	3.60e-53	42	591	17	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
5NIT_A	1.10e-52	43	597	19	579	Glucose oxidase mutant A2 [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	1.73e-90	24	596	20	618	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	3.13e-61	42	592	47	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.13e-61	42	592	47	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	1.48e-58	1	591	1	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P13006|GOX_ASPNG	1.15e-51	43	597	43	603	Glucose oxidase OS=Aspergillus niger OX=5061 GN=gox PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000817	0.999152	CS pos: 21-22. Pr: 0.9693

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002445-t41_1-p1.