CAZyme Information: jhhlp_002442-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002442-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551	NLAX01000008|CGC31	62305.14	7.3439

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:2685928-2687954(+)

Full Sequence      

MFHELRFGHIPLQGGLKLQVLQRITDLSRCQKHHFAAFVIEPPVLVVWEDDPNNIISRVD
RLESDIVSLVWKVDDDDDEKEASKETKEYYGDEKRRRDPGDETGAAHESNYGGVVSYTRN
RLPRPELEGPRTRGSVGWLLFQAFSPGCISIQLFVSLFFFQTAIGNIFQIFGPISAVNSN
SRHYSRKAPKRLSRSKTLPHVTIQMPVYKQGLNAVIRPTIASLKAAISTYEMQGGMANIF
VNNDGMQSIDVKMAAARRDFYEEHSIECVAQPPHNPKPEDPIVKLLCGRANSRKPTTSRT
SSKPSLVDLDELGNKKRQQSESRTWAGGNIRIGDYILFVDSDTRVPRDCLLDAVSEMEQS
PEVAIIQHTSGVMAVTDSFFERAVTWFTNLIYTSLKFCVANGDICPFVGHNAIVCWQAIQ
DTAAYIDPDDGNENPQAMFFVSRRTPMASSKEGVSPTVYDELARGERYAFGCNELLFHPL
RFSLTRGPLAPVKHADPHELPPYRLVLWLIRQILHRFFRHFIYLSIIVVFPLMGNFALSI
LRYRLGEEGLL

Enzyme Prediction     

No EC number prediction in jhhlp_002442-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	335	534	1.5e-27	0.8984771573604061

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.14e-28	335	510	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	6.11e-06	333	425	79	172	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
132997	Glyco_tranf_GTA_type	6.44e-06	333	392	78	136	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
133029	GT_2_like_c	1.41e-05	325	367	62	109	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
395426	Glycos_transf_2	9.48e-05	333	414	79	159	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC78319.1|GT0	5.31e-164	10	551	199	814
AEO63469.1|GT0	6.70e-153	9	551	237	859
EAA31611.3|GT0	8.55e-151	10	549	143	754
CDP26057.1|GT0	1.65e-150	9	551	206	820
CAP73654.1|GT0	1.65e-150	9	551	206	820

PDB Hits     

jhhlp_002442-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

jhhlp_002442-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

Start	End
138	160
521	543