CAZyme Information: jhhlp_002428-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002428-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	NLAX01000008|CGC12	93506.97	4.7774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:2639904-2642490(-)

Full Sequence      

MANLSYLLTLLVALCCSPRFLAAAEDGESVLHSEVSRANNQSLFWGPYKPNLYFGVRPRL
PQGLWTGLMWGKVNDFESVRSSFRYTCEQHEGLAGYGWDEYDIRRGGVETIHDVANEVDI
TVSFVKVPGGAHGGSWAARIKGVPREGAPANLQTMLTYYIAQEGSGELEVKTEGEQTGFE
SDILLAGNSDTLGDYKLVITKGTGDHPTSDHELTDRRQPDKTTVRSAQIPDEVLWQAKAV
VFKQLSDGISYIQNKYEPENSPPPFLVYQLENNPGKGNLHIVQKIFEGPFEFDVLFSSDS
AGKDLTDADLTAQIKANSEAFNDKFSQIFELRAPFKDDKYKSFAKTMFSNLVGGIGYFNG
YHLVDRSYAPEYEEESERFWEETAEARARKQEKLEGPYELFTSIPSRPFFPRGFLWDEGF
HLIPIMEWDNDLALDIVKSWFNTMDDDGWIAREQILGPEPRSKVPEDFQVQYPHYANPPT
LFLIIENFMNSLRKMNGSLPERKEILSFPETPLESAHLDFPELGETYLRSIYPQLRLHYD
WFRKTQRGDIKSYDREAFSTKEAYRWRGRTETHCLTSGLDDYPRPQPPHPGELHVDLMSW
VGFMAKSLMSIADALGMAEEVEEYKKTSHAIERNLNDLHWSEQEGCFCDATIDDFEEHTL
VCHKGYISLFPFLLGLMKPEDPKLGRILDLIGDEDHLFSPYGLRSLSVKDEFYGTAENYW
RSPIWININYLAIVQLHDLGAQDGPYKAKAADLYKRLRKNVVDTVYNSWVETGFAWEQYN
PDTGKGQRTQHFTGWTSMVVKIMAMGDIPTASGGHIRDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	592	803	9.2e-33	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	305	805	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.80e-104	43	263	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.35e-07	527	754	360	566	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95015.1|GH63	0.0	22	820	18	815
CCT67252.1|GH63	0.0	21	820	17	813
UQC82469.1|GH63	0.0	23	820	26	820
QGI63288.1|GH63	0.0	21	820	17	813
QGI94171.1|GH63	0.0	21	820	17	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	6.70e-174	34	803	6	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	3.90e-138	43	804	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.37e-225	34	804	33	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	6.61e-173	34	803	36	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	3.77e-138	43	804	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	3.35e-135	43	804	92	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	3.18e-127	43	804	94	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.022971	0.976994	CS pos: 23-24. Pr: 0.7952

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002428-t41_1-p1.