CAZyme Information: jhhlp_002386-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002386-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406		45251.83	4.3860

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:2492498-2493923(+)

Full Sequence      

MKFAVTLSLSALALAAGDLRDIPVTREGTHLYLNGTEWKAVGPNVYWIALDENVVPPDGE
PFYEPKKISYPHPDRVTEMMRVVKALGGTMIRAHTLGSNTGSPLSLMPEEGVINEDAWES
IDWAIYQARQHGIRLMVPLVDNYDYYHGGKFDFLRWAGHNFTQSRDSTNPAIMAFYEDPA
IVASFKSYITTLLTHLNPLTNLTLADDPTIFAIESGNELLGPSWGDMNCPANWVRDIARH
VKDLAPSKLFVDGTYGINTTHFDVDEVDIFSDHFYPVDPSKLRSDIAKLEAAGRPLFVGE
YGWTPDDNPGAGGDPLPEFFRIIEESDAVIGDTFWSLFGRNMPDCNDWVEHDDGFTMKYG
DPTNSDAVNNRIKLIRKHFTYMSQGVDIGVDEGLPTIPCPLSEGVE

Enzyme Prediction     

No EC number prediction in jhhlp_002386-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	112	307	3.6e-37	0.703125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	5.47e-05	32	253	5	182	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDR37878.1|GH5	7.83e-81	17	403	219	589
QBD78350.1|GH5	1.62e-75	24	378	37	353
ATO15951.1|CBM23|GH5	1.13e-71	24	383	48	378
QJC50849.1|GH5	1.73e-71	24	388	7	333
QLQ38406.1|CBM23|GH5	5.72e-71	24	383	47	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RH9_A	6.34e-21	24	347	7	346	Chain A, endo-beta-mannanase [Solanum lycopersicum]
3PZ9_A	1.33e-17	27	325	17	298	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	7.30e-17	28	325	1	284	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]
4QP0_A	4.72e-13	58	337	15	326	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]
3WFL_A	7.90e-12	27	375	7	342	Crtstal structure of glycoside hydrolase family 5 beta-mannanase from Talaromyces trachyspermus [Talaromyces trachyspermus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0JJD4|MAN2_ORYSJ	2.62e-24	24	256	55	265	Mannan endo-1,4-beta-mannosidase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN2 PE=2 SV=2
sp|Q5W6G0|MAN5_ORYSJ	4.23e-23	75	256	115	290	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2
sp|Q0JKM9|MAN1_ORYSJ	4.27e-22	24	384	38	418	Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN1 PE=2 SV=2
sp|Q0IQJ7|MAN8_ORYSJ	4.33e-22	27	375	5	370	Mannan endo-1,4-beta-mannosidase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN8 PE=2 SV=2
sp|Q9LZV3|MAN6_ARATH	8.89e-22	24	256	48	260	Mannan endo-1,4-beta-mannosidase 6 OS=Arabidopsis thaliana OX=3702 GN=MAN6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999684	CS pos: 15-16. Pr: 0.9504

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002386-t41_1-p1.