CAZyme Information: jhhlp_002226-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002226-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650		72587.01	4.1754

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:1752809-1754895(-)

Full Sequence      

MAPRFNRVAVALLAVAPVTQALYTDGEIVVPCDSPIYCHGDLLREVELARPFTDSKTFVD
MPGKKPLDEILAAFEKLEKPLKNDTALQDFLSEYFAEAGGEIVHVPTDELSTDPVFLDDI
DDVVIREFVGKVIEIWPDLTRSYVGSGECEDCPDSYLPVNRTFVVAGGRFREPYYWDSYW
IVEGLLRTGGDFIGISKNIIENFLDFVDEYGFVPNGARKYYLNRSQPPLLSQMVQAYVEH
TNDTSILDKAVPLLIKEHEFFTTNRSVEVELGNKTYTLNQYNVENNQPRPESFREDYITA
NNASYYAKSGEVYPEVEKLSDDEKALVYKNLATGAESGWDYTSRWMSRPSDAADDVYFPL
RYLNIVGTVPVDLNSILYGNEMAIAGFLEATGDSDSADEWRAKAEERSAAMYALMWNETL
HSYFDFNLTSGAQNIYVPADNDTADFERVTAPEGSQVAFNVAQLYPFWMGAAPAHLKDNP
LAVKLAYDRVARYLDLRAGAIPATNFRTGEQWDQPSVWPPLVHIIMAGLLNTPATFSDDD
PAYQATQDLALAVAQRYLDSTFCTWYATGGSTSETPQLPGFTSEDKGIMFEKYADNATNR
AGGGGEYEVVEGFGWTNGVLIWVADTFKNNLTRPDCGDIEAADVHPAKKL

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	52	625	1.4e-151	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	3.01e-129	52	621	3	502	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	6.90e-127	50	620	25	537	alpha,alpha-trehalase
224541	TreA	2.25e-84	34	621	53	546	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	1.68e-75	8	625	20	534	alpha,alpha-trehalase TreA.
183936	treA	7.96e-72	9	627	14	536	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATY63688.1|GH37	0.0	5	649	4	650
QPH18896.1|GH37	0.0	8	649	8	650
UPK93464.1|GH37	0.0	6	644	5	644
AAN38003.1|GH37	0.0	9	645	10	647
QBZ56021.1|GH37	0.0	9	645	10	647

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	1.24e-71	54	621	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	1.75e-70	54	621	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	1.57e-64	40	625	15	500	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	2.85e-63	34	625	46	537	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	1.53e-60	40	625	15	500	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	9.03e-117	32	636	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	1.22e-103	31	632	24	552	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	1.60e-102	31	632	27	555	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|P19813|TREA_RABIT	8.28e-101	31	632	27	554	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|A8J4S9|TREA_APIME	1.52e-100	31	635	40	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999736	CS pos: 21-22. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002226-t41_1-p1.