CAZyme Information: jhhlp_002101-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002101-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		24977.98	4.1901

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:1164696-1165614(-)

Full Sequence      

MISAGLLSSLALAAFPALVSGLRGRTFTSWDCCKPACGDSKYIDRSNATGLVAVCNVDND
VIRDSRRIVSGCDNGAAYMCDSYLPIPVADDYSYGFAVAPGYNCCKCYELFWLNGYAAGK
RMVVQVVNWMPDEEEGTDAGRPGDFAILTPGGGSGPHESGCIRQYGATWGEDYGGVSSMS
DCEQLPENLQGGCYWRWNWAGGEITGWDVEYKQIECPARLTEISQCTPAPF

Enzyme Prediction     

EC	3.2.1.4:43	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	28	226	1.3e-46	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	5.36e-30	30	226	8	213	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ75963.1|GH45	2.43e-67	18	228	17	222
CAC94522.1|GH45	2.43e-67	18	228	17	222
VBB84601.1|GH45	1.17e-57	25	226	27	243
QYY49566.1|GH45	1.10e-52	24	229	29	231
ADV02789.1|GH45	3.23e-47	24	226	23	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5H4U_A	1.18e-40	12	230	7	225	Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_B Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus],5H4U_C Crystal structure of cellulase from Antarctic springtail, Cryptopygus antarcticus [Cryptopygus antarcticus]
2ENG_A	5.12e-37	24	226	3	199	Endoglucanase V [Humicola insolens]
6MVI_A	5.26e-37	1	226	6	221	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
3ENG_A	5.55e-37	24	226	3	199	STRUCTURE OF ENDOGLUCANASE V CELLOBIOSE COMPLEX [Humicola insolens]
1HD5_A	7.83e-37	24	226	3	199	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D3GDK4|GUN_CRYAT	5.14e-40	12	230	7	225	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|P43316|GUN5_HUMIN	2.86e-36	24	226	3	199	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|P45699|GUNK_FUSOX	4.23e-34	10	226	7	219	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|O97401|GUN_PHACE	2.03e-29	24	226	40	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	3.50e-19	13	221	258	493	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000284	0.999672	CS pos: 21-22. Pr: 0.9734

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002101-t41_1-p1.