CAZyme Information: jhhlp_002005-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_002005-t41_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		41713.82	7.0620

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000008:741139-742475(-)

Full Sequence      

MKAVSVLSALLAAVPSVYGQVKGVPFGFANTVTGGGSATPSYPTTNAELASMLSDSTPRV
IMIDRTFDFLQTEGSTTTNCCSDDRTTKCPGGSSAGQLWIQNTCDGGSWQSCTYWNAPRT
PLKVASNKSIIGVGTKGVLRGKGLRLSGGVSNVIIQNIHITELNPQFVWGGDAITLDGCD
NVWIDNNKFSLIGRQMIVSGWGTGGRVTISDNEFDGKTSWSAGCNGKHYWTMLLLGLKDY
YTIAGNWFHDLSGRAPHIGTDYTSSQILVHAVNNYFQNIDGHAFDVDTNTWMLIEGNYFE
NVKTPITADSYNKGGQVYFIQTVADASNAASPLGYIPEWNRFSGSGTVNSIVSQNALSKL
GAYKGNIMWEHWAVANVPGNVKAIAGVGK

Enzyme Prediction     

EC	4.2.2.10:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	112	301	1.6e-84	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	6.21e-43	119	303	9	190	Amb_all domain.
226384	PelB	4.90e-19	24	389	40	343	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	9.15e-14	119	299	27	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI67769.1|PL1_4	4.24e-214	10	389	9	391
UPL00849.1|PL1_4	3.13e-182	7	389	8	388
UDD64891.1|PL1_4	6.06e-178	7	389	9	390
QMW47813.1|PL1_4	8.60e-178	7	389	9	390
QRD93342.1|PL1_4	8.60e-178	7	389	9	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	9.97e-89	21	376	3	354	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.14e-81	21	388	3	357	Pectin Lyase A [Aspergillus niger]
1IDJ_A	5.07e-80	21	388	3	357	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
3VMV_A	5.21e-15	113	302	57	249	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
2QXZ_A	7.23e-09	112	308	56	255	Chain A, pectate lyase II [Xanthomonas campestris pv. campestris],2QXZ_B Chain B, pectate lyase II [Xanthomonas campestris pv. campestris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DEH0|PELF_NEOFI	1.21e-176	5	389	4	385	Probable pectin lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelF PE=3 SV=1
sp|B0Y0L8|PELF_ASPFC	6.96e-176	5	389	4	385	Probable pectin lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelE PE=3 SV=1
sp|Q0CFF7|PELF1_ASPTN	3.84e-171	1	389	1	387	Probable pectin lyase F-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-1 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	2.30e-104	8	389	11	382	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	2.30e-104	8	389	11	382	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000503	0.999465	CS pos: 19-20. Pr: 0.9772

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_002005-t41_1-p1.