CAZyme Information: jhhlp_001733-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_001733-t41_1-p1
• CAZy Family: AA8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	NLAX01000005|CGC4	40697.97	7.5553

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000005:242027-243213(-)

Full Sequence      

MFTSRISLPYRRLILVLISTSFLTILLILHLKNDIYSLWTLLSLPFSWPRGSESFYISRE
VDEFDVSFANYSETETSAGDNYTARIPALLHHISLGPAPTRDSWAEARQSCLDAHPDWQA
ILWNDENAGKFIAERFAAFKPTWDSYRFLIQKVDALRYLVLYEFGGVILDMDLHCKRSLG
PLRRFHFVAPAAFPTGFSISFMMAERHSEFVKQLIQNLKAYDRRWFYLPYPTIMFSTGGH
FASAIHTLQSNRSEFKVLTGPKNDFWQHSLNGPVSTPLFDHLGSASWHSYDGRLLVLLVE
CVKWMLPILIIGVVCFLLLVTDRLSLLVRKWRLQPPNTELEEKDLEDRWVR

Enzyme Prediction     

No EC number prediction in jhhlp_001733-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	104	183	3.1e-19	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.09e-22	24	246	12	240	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.64e-16	102	182	2	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO68738.1|GT32	5.34e-113	32	313	33	315
QLI73314.1|GT32	1.14e-106	28	298	29	296
UNI15446.1|GT32	1.18e-105	32	296	36	294
QPH09562.1|GT32	7.75e-104	32	296	34	294
ANH56537.1|GT32	2.20e-103	32	298	34	296

PDB Hits     

jhhlp_001733-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	7.66e-33	86	295	55	259	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.54e-32	59	296	39	270	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	9.18e-31	81	291	52	258	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	8.79e-29	86	293	62	265	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.61e-27	86	238	82	232	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000006

TMHMM  Annotations     

Start	End
13	31
185	204
225	247
304	321