CAZyme Information: jhhlp_001726-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_001726-t41_1-p1
• CAZy Family: AA8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
895		99354.92	4.4730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000005:210209-212896(+)

Full Sequence      

MERKSIAMLVFNLLLLALTHSASALVPRRPHDDHSASRRERVSINNGWRFSRSVSSPDKV
VYEPRPDLDVGRDVQTLKPWILPLANDFINDPANHYEVPAEDPVGDIPFTLGDFDDSDWE
EVNVPHDWAIQGPFYTEQDPIVGGGMGRLPIHGVGWYRQKLTVTPADEGKTIYLDVDGAM
SYPLVWLNGHLVGGWPYGYNSFRLELTPHLKLGKDNQVAIRVDNPTDSSRWYPGGGIYRN
VWLTKVDPIHVAQWGTYITSTDVSEESATIDLILTLENKGPKEGEVEVVVEVHEIDDGRV
GEEVARFPTQTVTVELDQKTTLNLSTTVENPKLWGPPPTQEPNLYVAVVRVFKGKEELDT
YETRFGIRAVVFSGDDGLIINGERIQIRGVNQHHDLGALGAAFNVRAAQRQLEVLRDLGS
NAIRMAHNPPATELLELTDEMGFLVIDEIFDCWEREKNPSDFHLIFKEWHEADLRSFMRR
DRIHVSVIAWSIGNEVGEQYTEEAGAALADSLRKIAHEEDPTRPATASMNYAKPDMPFPG
SLDIISLNYQGEGIRDAPAYSHLQGIKTSPLYQAFHDKFPDKLIFGSETAAALSTRGTYL
FPVTNETSAPVADGSGGDPIAEQVSAYELYTAPFGSSADKVFSAQDHHPFVAGEFVWSGW
DYLGEPTPYYTARSSFFGIIDLAGFPKDRYFLYQSRWRPDLPFAHILPHWTWPDREGQVT
PVHVFSTGDEAELFVNGESQGRLQKEEYTYRFRWDDVVYQPGEVNVVVYKNGEEWAEASV
QTAGEAARFDISVDRDIIATDGLDLAFIAVKVVDDEGVMVPGANNEITFGVSGAGELVAT
DNGDPADMTSFPSATRKAYNGLALGIVKAKPGSKGPITVTVTADGISDAEITINE

Enzyme Prediction     

EC	3.2.1.23:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	34	765	1.2e-109	0.6808510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.89e-49	72	716	3	619	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
408349	Glyco_hydro2_C5	2.86e-39	792	892	4	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
236657	PRK10150	2.66e-38	156	548	68	470	beta-D-glucuronidase; Provisional
236673	ebgA	4.38e-29	115	523	67	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
406696	DUF4982	9.70e-24	717	777	1	61	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73882.1|GH2	0.0	4	893	13	906
ADB37765.1|GH2	0.0	39	893	46	919
AEO63777.1|GH2	0.0	39	891	34	892
QJD98441.1|GH2	0.0	37	887	18	887
ANH81488.1|GH2	0.0	9	893	15	914

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	3.46e-189	114	894	49	819	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
7CWD_A	2.25e-171	114	893	28	799	Chain A, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	1.84e-168	114	887	34	799	Chain A, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_A	1.02e-138	54	893	13	874	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]
6QUB_B	1.90e-138	98	893	24	851	Truncated beta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7LXS9|BGH2A_BACO1	6.53e-184	106	894	50	847	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
sp|T2KM09|PLH16_FORAG	6.15e-100	109	885	65	811	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
sp|T2KPJ7|PLH8_FORAG	2.26e-52	101	741	64	673	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
sp|T2KN75|PLH17_FORAG	1.15e-51	114	893	50	793	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
sp|P77989|BGAL_THEP3	5.29e-50	113	838	26	694	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999771	CS pos: 24-25. Pr: 0.9713

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_001726-t41_1-p1.