CAZyme Information: jhhlp_001629-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_001629-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674		73066.08	4.3560

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000004:2592999-2595345(-)

Full Sequence      

MASRALVLLGAIALANALPHQRVIKRQVEELRESYDFVVVGGGTAGLTIADRLSEAFPER
NTLVIEYGVIEDAEAVFEPPGGGPGNKRLNIQSLPIPALNNRRASLTVGMTVGGSSTING
QFFDRGHKLDYDDWAKIGSPEFDDSAESWDWDNIIPFFKKSVTFFEPSEENAEAYGYTWD
VDAAYGLNVSNIQAVYAQYQFPIQKIAWDAFVEMGVPTPTECAGGDKHGACWVPASQYYL
DGQRSHAGRGHYLEVIDDRSNYDLLVGHKVTRLIVGEADAPPAIEFKPVDSTDDEDVRTV
TPNLEVVVSAGAIHSPQILQRSGIGEAAFLEAAGIEVVVDLPGVGHNFQDHCGPGASFAQ
GENLVYYPRLMIPELTHALNPVAESVQPSQGSINSNETFAAEARELYEERPAKGPYTLAM
GNSAIYLSLPFITEDSADIVAAIRAQIDDGTALDYLSEATPDAVKDGYLAQLSVLADALE
NPEHPVLEAPWMSSTPAGGFLLKPLSRGTVLLDPENIDGEPIIDYRTGANPIDMEVMARF
LPFFRRYYDTNTMVALGPREISPGSNVTEIEDIIEFIRGNITPSFMHPCCTASMMPKEKG
GVVGPDLKVHGLDRVRVADISIIPIIPGTHTSATAYAIGEKAADIIIRSWPSEESEGSVE
EPPKCKSKRSAGKN

Enzyme Prediction     

No EC number prediction in jhhlp_001629-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	34	647	1.2e-139	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.38e-66	33	646	4	531	choline dehydrogenase; Validated
225186	BetA	1.04e-64	33	648	6	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.01e-33	504	642	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.96e-22	97	351	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	3.74e-08	33	648	54	578	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO67447.1|AA3_2	1.19e-188	1	650	3	640
VBB84441.1|AA3_2	1.05e-170	1	650	9	633
CDP31201.1|AA3_2	3.40e-162	19	653	24	636
QRD01783.1|AA3_2	1.31e-146	123	650	3	507
EGX43942.1|AA3_2|CBM1	2.00e-127	6	646	14	618

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	6.98e-203	6	654	8	646	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	8.26e-103	31	646	2	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	6.48e-46	34	646	5	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	2.07e-45	35	646	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	9.95e-45	35	646	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	8.08e-86	4	646	11	613	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	1.45e-56	33	647	45	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	1.45e-56	33	647	45	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.24e-54	34	646	39	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.56e-50	18	646	21	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000606	0.999377	CS pos: 17-18. Pr: 0.9680

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_001629-t41_1-p1.