CAZyme Information: jhhlp_001595-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_001595-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637	NLAX01000004|CGC7	69598.11	4.1878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000004:2452266-2454447(-)

Full Sequence      

MSLKAALFASLVASIGASPLRVIKRQVSELDDSYDFVIAGGGTAGLTVADRLSEAFPDKS
VLVIEYGEVEYAAGVFDPPQVIWRGEGGDSATAFVFNSLPNPEVLNKTAFVMAGQAVGGS
SCINGQFFDRPSKWDFEAWNQLLGPEYDDCDTKWDWDGIYDYFKKSVTFTEPPASVVAEH
GYTWDLDAYGGSTPIYSSFPPFLWGDHYVFRDGFQELGAPVLEECAGGDKNGVCWIPTSA
DPVTFLRSHSGIGHYTAVNETRSNYHLLVKHQVTRVLYEQGLDHTPIVEVRDLSDDSIFT
VSADLEVVLSAGTFHTPTILQRSGIGPASYLEQADIDVVLDLPGVGSNFQDHSGPGLEWN
YTKPADWFPLATDMLDDDFLADATAGFDEVPARGPYTLAMANMALFLSLVNVTSEYATIV
AKIRDQVTSGTAASFLPLDYRDDPEMIAGYELQLSVLADLFENPELPSLESPYATGGTAL
PLISLHTLSRGTVRLDPANHFEQPIVDYRTGSNPVDFDVHLAHIKYLREVFNTPTVKQYE
PLVWGPPDELQSDEDLIQYIKETMVFSYMHPCCTAAMMPKEKGGVVGPELKVHGASGLRV
VDMSVIPILPSSHLSAEAYAIGEKLEQAADLIIAEHS

Enzyme Prediction     

No EC number prediction in jhhlp_001595-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	33	633	1.8e-143	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.42e-64	28	636	2	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.35e-58	33	632	5	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.93e-33	489	625	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.46e-19	106	352	16	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.27e-11	28	351	50	326	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84441.1|AA3_2	8.31e-249	17	635	22	632
AEO67447.1|AA3_2	3.77e-242	1	633	1	637
CDP31201.1|AA3_2	4.95e-239	17	635	22	632
QRD01783.1|AA3_2	2.24e-212	128	634	3	505
UQC77231.1|AA3_2	5.39e-127	24	632	34	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	1.58e-255	12	635	14	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	4.25e-103	33	636	5	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	4.81e-52	33	632	5	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
4H7U_A	1.29e-49	34	623	41	591	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
6XUT_A	3.96e-46	33	632	16	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.87e-94	22	636	28	617	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	2.55e-65	33	633	46	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.55e-65	33	633	46	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.10e-53	11	628	8	628	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	1.04e-50	31	623	38	589	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.801178	0.198843

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_001595-t41_1-p1.