CAZyme Information: jhhlp_001215-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_001215-t41_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	NLAX01000004|CGC11	53724.97	4.6842

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000004:757400-759322(-)

Full Sequence      

MSLPKDFLWGFATAAYQIEGAAEKDGRGPSIWDTFCAIPGKIADGSSGAVACDSYNRTAE
DIALLKDLGVTAYRFSISWSRIIPLGGRNDPINQAGIDHYVKFVDDLTDAGITPFVTLFH
WDLPDGLDKRYGGLLNREEFPLDFEHYARTMFKALPKVKHWITFNEPWCSAILGYNTGFF
APGHTSDRSKSAVGDSAREPWIAGHNMLVAHGRAVKTYREDFKPTNGGEIGITLNGDATY
PWDPEDPEDVAACDRKIEFAISWFADPIYFGKYPDSMLAQLGDRLPTFTDEERALVQGSN
DFYGMNHYTANYIKHKTGTPPEDDFLGNLETLFDSKNGECIGPETQSFWLRPNPQGFRDL
LNWLSKRYGYPKIYVTENGTSLKGENDMERDQILEDDFRVAYFDGYVRAMAEASEKDGVN
VRGYLAWSLLDNFEWAEGYETRFGVTYVDYENGQKRYPKKSAKSLKPLFDSLIKTD

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	468	3.6e-161	0.9766899766899767

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	0.0	2	466	4	445	Glycosyl hydrolase family 1.
225343	BglB	4.00e-148	1	471	2	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	5.16e-112	2	462	27	473	beta-glucosidase
184102	PRK13511	1.29e-110	2	473	4	467	6-phospho-beta-galactosidase; Provisional
215455	PLN02849	2.47e-104	4	462	31	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC78120.1|GH1	0.0	1	474	1	474
CAP69093.1|GH1	0.0	1	476	1	476
CDP32570.1|GH1	0.0	1	476	1	476
VBB87046.1|GH1	0.0	1	476	1	476
AII80277.1|GH1	0.0	1	476	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	0.0	1	476	24	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	3.32e-273	3	473	3	463	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	3.53e-272	3	473	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]
5JBK_A	9.06e-271	1	473	1	463	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	7.45e-270	3	473	22	482	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	8.54e-191	3	473	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	3.90e-175	3	473	6	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q7XKV4|BGL12_ORYSJ	5.76e-143	2	462	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|B8AVF0|BGL12_ORYSI	3.27e-142	2	462	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1
sp|Q7XKV5|BGL11_ORYSJ	9.69e-141	2	466	39	505	Beta-glucosidase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU11 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000004

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_001215-t41_1-p1.