CAZyme Information: jhhlp_001098-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_001098-t41_1-p1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	NLAX01000004|CGC5	35496.55	3.9628

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000004:252318-253622(+)

Full Sequence      

MPSYSTCSLQHVALTGLAIWASLAAALPSDRPDLSDTSIPFVALFGGDVALRILPLGDAL
THGTSAFPSSYRAPLRDLLVADGNPVDYVGSSTSGSLPNDDNQVEAPADVGAAPLATVVS
AAKTAVPAYKPNIVIIHAGADDCRQGADVSDASARYLEILTTAWTSIFATAVLTTLPPSR
DAAVESCLVELNRQIADLVAAQQASSRKVVLVDFRAADAGITLEDLTDDVDGEPFPSEEA
YGKMAGLLFEGIRNAASRGWLEAPETLPDAPEEPKADPSSSATGTSAVTLPTDQASGSRL
GGSSPEADEVEDVAQGNGAAADQSGAARGVVSGLAALLGLAIGVGMTLV

Enzyme Prediction     

No EC number prediction in jhhlp_001098-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	51	249	1.1e-33	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	8.78e-16	51	252	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	5.81e-08	53	250	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	2.84e-06	125	241	56	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC79481.1|CE0	1.84e-51	4	269	2	258
UNI21161.1|CE0	1.69e-38	8	271	9	258
AEO66483.1|CE0	2.49e-32	23	273	11	259
AVF19998.1|CE3	1.97e-31	46	264	12	222
UQC73362.1|CE0	2.87e-30	46	264	12	222

PDB Hits     

jhhlp_001098-t41_1-p1 has no PDB hit.

Swiss-Prot Hits     

jhhlp_001098-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000803	0.999159	CS pos: 26-27. Pr: 0.9654

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_001098-t41_1-p1.