CAZyme Information: jhhlp_000920-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000920-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
880		97204.75	4.9669

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000003:1477897-1480949(+)

Full Sequence      

MGSLDFRNEDHDSDSNVSPMESDMANSTPNTEFSPPCSPQHKAQILKDTRLSARKKLAQL
TLEEKVSLLTAADFWRTKSIPEKNIPSIKTTDGPNGARGGIFVGGTKAALFPCGVSLAAT
WNKALLREVGHHLANEVRARSANMLLAPTICMHRHPLGGRNFESFSEDPLLTGKLSAQYV
RGLQEKGVSATVKHFVANEQETHRLTVDSVVAERPLREIYLRPFEITVREANPWAIMSSY
NLINGIHADMNEHTLKDILRGEWGYDGAVISDWAGMNSTAESLKAGCDIEFPYSPKWRFE
KLIDALNKGQVTQEDIDRAAENVLTLVERLKGDDMSPEEPEREDDQPETRQLIRTAGAEG
LTLLKNEGAVLPLCADTTKVAVIGPNANRAIAGGGGSASLNPYYNTIPLDSIKRTAKKEV
IFAQGCHIYKWLPVASPYCTEKSGQPGVNIDWFRGDKFEGEPVVVQRRTNTDLFLWDSAP
LSQVGPEWSAVATTYLTPSSSGRHTISFMSVGPGKLYVNGKLELDLWDWTEEGEAMFDGS
IDYLVDVDMEAGKPVELKVEMTNELRPVSKQKQFGITHKYGGCRIGFKEQDQVDYIQEAV
DAAKAADVAVVIVGLDAEWESEGYDRQTMDLPVDGTQNRLIEAVVAANPKTVVVNQSGTP
VTMPWADKVPAILQGWYQGQEAGNALADVLFGIQSPTGKLPCTFPKRIEDTPAYHTWPGE
NLKVVYGEGIFIGYRHYERSKIEPLFPFGHGISYTTFEYGRPELKQRVLTEDGTIDIIMG
ISNTGAVDGAEIIQVYVSDEKSRLPRPEKELVAFEKVALPAGETRHIRISLDKQAVGYYD
TSLNAWIAEEGTFKVLIGASSADIRHTATFEVKESFTWVF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	291	1.9e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.86e-82	111	871	120	763	beta-glucosidase BglX.
224389	BglX	5.23e-72	73	428	48	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	9.01e-53	25	832	22	743	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	8.26e-50	361	734	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.16e-44	85	326	66	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99043.1|GH3	0.0	27	880	8	861
UQC88307.1|GH3	0.0	44	880	45	873
CEI68241.1|GH3	0.0	27	880	8	861
CEF85907.1|GH3	0.0	20	880	1	857
CZS83428.1|GH3	0.0	20	880	1	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	7.07e-191	49	878	2	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.15e-186	49	878	2	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.61e-151	54	877	6	679	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	7.46e-125	60	868	12	659	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.82e-117	57	874	8	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.03e-228	57	864	15	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	5.55e-206	50	879	3	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	3.20e-202	49	879	2	837	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	4.39e-202	50	879	3	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.74e-201	50	879	3	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000920-t41_1-p1.