CAZyme Information: jhhlp_000758-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000758-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241		26724.20	4.4040

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000003:768267-769276(-)

Full Sequence      

MTFGLSIFTCREFRMVKTAAALALAALSGVLAQEPLRYMPFGDSITDYGCWRPWLAEKLK
EDGYTLEFVGSRQAQATCNDLDYDRDHEGHPGFQAVDIVKDNQLVGWLNDNPADIITMHL
GTVDIVRSSTKADLIIEAYSTLVDQMRDNNPAMRIIVAQIIPFPANDRLVQDLNAAIPKW
AASKNTTESPIWVVDQYTGFSGTTDLYDGLHPSESGDVKISEKFYPAMVQAIQSLVGGRD
E

Enzyme Prediction     

No EC number prediction in jhhlp_000758-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	36	227	2.2e-54	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.57e-51	36	228	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	7.39e-15	41	227	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	2.67e-13	41	216	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	2.41e-08	38	224	1	224	GDSL-like Lipase/Acylhydrolase.
238879	NnaC_like	1.17e-05	42	223	7	169	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB71398.1|CE3	3.35e-76	32	238	23	235
CDP22404.1|CE3	3.16e-73	32	238	23	232
CAP59760.1|CE3	3.16e-73	32	238	23	232
QRD06229.1|CE3	9.42e-69	24	235	12	226
AXI79013.1|CBM2|CE3	7.13e-59	19	232	17	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	5.16e-39	36	235	2	206	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	1.45e-38	36	235	2	206	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

jhhlp_000758-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000396	0.999563	CS pos: 32-33. Pr: 0.9744

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000758-t41_1-p1.