CAZyme Information: jhhlp_000713-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000713-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870	NLAX01000003|CGC7	93881.62	5.6036

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000003:563093-565815(-)

Full Sequence      

MGDAAHSLRDGGVSESLDSFTLHPGTIVNTMAPAVDLEAILKSLTLEEKISLLSGGTFWE
TQAIPEKGVPSIKTTDGPNGVRGVDFEGSTRAACFPAASSIAATFDPIIAHNVGRALAEE
ARSKGASCLLAPTVCLHRHPLGGRNFESYSEDPMVAGKLAAQMITGVQSLGVAATIKHFV
ANEQETDRMTVDETISERALRELYLRPFEIAIKEAGPWAVMTAYNKVNGEHCDGHEFLLS
KVLRGQWGWKGLVISDWGGTNSVEDSINHGLEVEMPGPARVRKTDVVLEAVKAGRVKESA
IDDRVRNILSFLEKLKAFEGATPTSERAIDRPEHRKLIRDAGARGIVMLKNENQTLPLSK
EKVKGKKIALIGFAKDALAHGGGSAGVNAHYKITPFDALQSALGDSAEFTYAKGVHRERL
LPSISKDDTSVGTVVGLDGQPGFSISFFEPSDLSKPVSTQHGLEKSAYSPLGSQESIWKV
LEIVGDFTPSESGSHILAASGIGSTQVFINDQSVFEQQGNYSDPMGVLFNAQTETEFHYQ
FTAGQTYRIRIQSHPPTNVGLKILEGRTGMRMGFGLASVYEADLLGEASQVAKDADYAIV
FTGHDPQWETEGRDQESFHLPRNGSQDALVSAVAGANKNTIVVNSTGVAVAMPWLEDVSA
LLHTWFPGQECGNSIADVLTGAVNPEGHLPVSFPKRVEDAPAHGNFPGVYVDGKLKVTYA
EGVFVGYRHYDRLAKDKLNFAFGHGLSYTSFDLGNLKVTKKSSDAYTVTVDVTNTGSVEG
GTVAQIYGGKAEQREGHPIKALVAFQKTRLQPGEKETLEMTFATRDLGYYDESTQRWVVE
AGQYKVALARSAADIVQEAEIDVERLVYAP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	63	276	5e-65	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.95e-74	95	862	120	763	beta-glucosidase BglX.
224389	BglX	2.30e-73	40	372	34	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.27e-52	346	727	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.70e-48	39	821	55	741	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	9.43e-45	62	310	57	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC73924.1|GH3	0.0	31	868	26	865
UPK95449.1|GH3	0.0	31	870	1	838
QPC70884.1|GH3	0.0	35	870	4	837
CEF78442.1|GH3	0.0	35	870	4	837
QGI87315.1|GH3	0.0	36	870	5	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.13e-173	36	868	5	841	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	5.65e-170	36	868	5	841	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.20e-131	34	867	2	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.01e-112	40	855	7	705	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	2.18e-112	41	864	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	0.0	37	870	11	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.64e-190	37	855	2	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	8.34e-187	35	868	4	834	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	8.34e-187	35	857	4	824	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.30e-186	35	868	4	834	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000713-t41_1-p1.