CAZyme Information: jhhlp_000639-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000639-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618	NLAX01000003|CGC5	68294.43	4.8768

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000003:275719-277575(+)

Full Sequence      

MRSLGSSSLGALAALTLSMLSSPAMAQVVPPAGTETGVLVQPFELSSVSLGDSRWADNQN
RTLSYLLWVDPDRLLYNFRSNHGLSTQGATPHGGWDAPDFPFRTHYQGHVLTAWAYCWSV
LGEQACKDKATYFSAELKKCQANNPAKGYSEGYLSGFPESEIEAVEKRTLSNGNVPYYAI
HKTMAGLLDVWRFLGDETAKDVLLGMAGWVDSRTGKLSYAQMQEMMQTEFGGMNEVLADV
AHQTGDNRWLTVAQRFDHQVVFDPLAANQDRLNGLHANTQVPKWIGAAKEFKASGNTRYL
DIAKNAWAMTVNAHTYAIGGNSRSEHFRPPNAIAEFLDNDTCEACNTYNMLKLTRELWVM
DPEDTDYFDFYERALLNHLLGAQNPESDHGHITYFTPLNPGGRRGVGPAWGGGTWSTDDD
SFWCCQGTQIETNSKLMDSIYFKDEENLYVNLFIPSTLDWTEKGVRVQQVTEFPAGESSK
LMINGDAEFTLRIRIPSWASDAKISINCEEVARPQAGSYAEVSRKWLSGDVVKVDFPMSL
HTVPANDDPSVAALAFGPVILCGNYGDSSLSGIPALDVTSVQRDGITLSFKGTSNGQAVN
LVPFYEAHGFNYNVYWKI

Enzyme Prediction     

No EC number prediction in jhhlp_000639-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	48	561	9.2e-198	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	2.32e-172	47	562	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	1.16e-105	45	566	9	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL00090.1|GH146	5.10e-308	25	618	13	611
CZS80932.1|GH146	5.30e-300	39	618	30	612
QPC58989.1|GH146	2.15e-299	39	618	30	612
CEF77637.1|GH146	3.05e-299	39	618	30	612
BDF83160.1|GH146	1.58e-297	28	618	17	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.87e-107	35	617	20	649	Chain AAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.04e-101	35	617	20	649	Beta-L-arabinofuranosidase [Bacteroides thetaiotaomicron]
5MQO_A	6.73e-13	327	562	371	607	Glycoside hydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

jhhlp_000639-t41_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000480	0.999506	CS pos: 26-27. Pr: 0.9704

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000639-t41_1-p1.