CAZyme Information: jhhlp_000612-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000612-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705		78091.51	5.2158

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000003:181733-184179(+)

Full Sequence      

MNLKASSRDDENDEAYPMLHLGQPADGESADRYSLDSEDPIIIKGEDKGSGGSALENGRR
KWRHAWRLLALGLFCILLLVLAGFLLAFFFHKPSGSRGPANGSNNPVVNLAELELDTGFT
ISNVPTTREYVFDVARALAAPDGLEKSMVLVNGQSPGPLIEANIGDVLRIKVNNRMAEES
TTIHWHGIEQRNTNWMDGVHRVTQCAIPPGESFTYEFNVTGQRGSFWYHSHLSVQYTDGL
YGPLIIHDPDEKVPPVDDDKIVMFGDFFYDEAEKLNELYLGPEHPWSPMMAGMEPPPDNI
LINGVHVTNCSAPPGANPKSKGATPVTDISLRCASGSLHNTRVKSGDRVRFRLISHSTST
PFWLTVDNHTLEIVEIDGTEVEPIATTRVFVNPGQRYSVLVSANQTAGNYFLRASAATPC
FHLPRGGAANLAGLNNEAVAILTYDDIDPKSGVIGLPWDLRSKSNADFGTEPWAMECDDL
PYDVAKPVRKEKEYEVGERNYHYFSFERHTVGGHVQTIINETTYKPLQNDATLWNVMEQF
SSTQDADSPARNGDFALDQVLITSQDADGGAQIVVNNRAMMMHPFHLHGTVLVQSPFRTT
EHRQSFQVIGWGRKDYGDGETTWSLDNPIRRDTITIPGFAHVVLRIRGDNPGVWAIHCHI
LWHAEEGMTLAIAQRLDELEEQLNRLDTAAAGQPLRRRFCSAGSG

Enzyme Prediction     

No EC number prediction in jhhlp_000612-t41_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	144	668	1.4e-108	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	4.64e-69	127	681	1	530	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
259926	CuRO_1_Diphenol_Ox	1.77e-64	128	247	1	119	The first cupredoxin domain of fungal laccase, diphenol oxidase. Diphenol oxidase belongs to the laccase family. It catalyzes the initial steps in melanin biosynthesis from diphenols. Melanin is one of the virulence factors of infectious fungi. In the pathogenesis of C. neoformans, melanin pigments have been shown to protect the fungal cells from oxidative and microbicidal activities of host defense systems. Laccase is a blue multicopper oxidase (MCO) which catalyzes the oxidation of a variety aromatic - notably phenolic and inorganic substances coupled to the reduction of molecular oxygen to water. It has been implicated in a wide spectrum of biological activities and, in particular, plays a key role in morphogenesis, development and lignin metabolism. Although MCOs have diverse functions, majority of them have three cupredoxin domain repeats that include one mononuclear and one trinuclear copper center. The copper ions are bound in several sites: Type 1, Type 2, and/or Type 3. The ensemble of types 2 and 3 copper is called a trinuclear cluster. MCOs oxidize their substrate by accepting electrons at a mononuclear copper center and transferring them to the active site trinuclear copper center. The cupredoxin domain 1 of 3-domain MCOs contains part the trinuclear copper binding site, which is located at the interface of domains 1 and 3.
225043	SufI	1.45e-61	151	668	57	442	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
177843	PLN02191	2.65e-61	128	699	24	567	L-ascorbate oxidase
274556	laccase	6.56e-60	127	671	3	516	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ59810.1|AA1	3.35e-204	93	700	89	688
AUS45860.1|AA1	6.63e-167	104	687	93	669
CAP71374.1|AA1	2.22e-156	107	701	117	692
CDP30774.1|AA1	2.22e-156	107	701	117	692
VBB83984.1|AA1	4.36e-153	107	701	117	692

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3V9E_A	1.22e-69	112	689	51	555	Structure of the L499M mutant of the laccase from B.aclada [Botrytis aclada]
3SQR_A	3.27e-69	112	689	51	555	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]
2QT6_A	2.58e-66	134	674	10	468	Chain A, Laccase [Lentinus tigrinus],2QT6_B Chain B, Laccase [Lentinus tigrinus]
5LWX_A	4.14e-66	101	678	23	536	Crystal structure of the H253D mutant of McoG from Aspergillus niger [Aspergillus niger]
5LM8_A	4.29e-65	120	678	16	508	Crystal structure of a laccase-like multicopper oxidase McoG from from Aspergillus niger [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VY90|LAC1_CRYNH	2.79e-90	115	667	49	553	Laccase-1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=LAC1 PE=1 SV=1
sp|Q55P57|LAC1_CRYNB	5.71e-89	115	672	49	558	Laccase-1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=LAC1 PE=1 SV=1
sp|J9VQZ4|LAC2_CRYNH	8.80e-85	115	674	49	561	Laccase-2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=LAC2 PE=3 SV=2
sp|Q99056|LAC5_TRAVI	1.82e-71	134	670	33	493	Laccase-5 OS=Trametes villosa OX=47662 GN=LCC5 PE=3 SV=2
sp|Q12717|LAC5_TRAVE	9.54e-71	134	674	33	497	Laccase-5 OS=Trametes versicolor OX=5325 GN=LCC5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999777	0.000238

TMHMM  Annotations     

Start	End
68	90