CAZyme Information: jhhlp_000523-t41_1-p1

Basic Information

• Species: Lomentospora prolificans
• Lineage: Ascomycota; Sordariomycetes; ; Microascaceae; Lomentospora; Lomentospora prolificans
• CAZyme ID: jhhlp_000523-t41_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
650		74442.84	5.4405

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LprolificansJHH5317	8768	N/A	208	8560

• Gene Location: location=NLAX01000002:1494235-1496513(-)

Full Sequence      

MEAPKPKACKVASRSTKGHYLIEFCSELGRQVGGIYTVIKSKAPFTKRQYDDRYLIVGPL
VRQSASLEAEPLTPPTPELSATLKALEMRGIHTVYGRWQIEGSPRVLLIDTTIGCGFLEE
WRDDFARLAGIPLPFPEDDELINESIIFGYLSAWFMEEFTKHEKEKVILAHFHEWPAALG
LLLIKRQQLDIVSIFTAHATVLGRELCTKGTDWYDILDTLDVDEEAKNIDHYHWHGLETA
VAHAADLFTTVSDITAQESEFLLRRKPDQVLPNGLNISQMTAFNEAENLRRTSSKRKLQD
FVRSHFYGHLDFNLEETLFFFIAGRYEFRNKGADIYIESLARLNDQLKAQNSDVTIVAFI
IMPAKTTSIKTETLKGKAVIKSLKDYVAEMNRNINTKLLEQALKWKEGDPIPTKLDLITE
QENIDFQRHLYSLQRKDLPPVCTHNLTNEKDDPILKRLKLVGLQNQASDRVKVVFYPSFL
NPSDPVLPMSYYEFMRGTHLGIFPSVYEPWGYTAAECVAMGIPSITSNVTGFGLYMEQLL
GEGTSDYGVYIVDRRSQDFDSSATQITEYMQQFCKMTHRERATLRHFTEDLSEVLDWEHM
ELEYDKSRRSALRLMYPGQVPQEEGDDWPRDIKEKLAQCVFNFIDVSGGL

Enzyme Prediction     

EC	2.4.1.11:48

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT3	23	624	1.7e-223	0.9419152276295133

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399009	Glycogen_syn	0.0	23	626	1	597	Glycogen synthase. This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).
340824	GT3_GSY2-like	0.0	18	613	1	589	glycogen synthase GSY2 and similar proteins. Glycogen synthase, which is most closely related to the GT3 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis. GSY2, the member of this family in S. cerevisiae, has been shown to possess glycogen synthase activity.
340831	GT4_PimA-like	1.46e-07	450	606	231	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340816	Glycosyltransferase_GTB-type	1.98e-06	451	532	149	222	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
400563	Glyco_transf_5	1.76e-05	148	258	112	223	Starch synthase catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD47351.1|GT3	7.64e-248	13	638	6	627
ATZ57676.1|GT3	7.64e-248	13	638	6	627
APA13542.1|GT3	3.94e-247	13	638	6	627
CAD70912.1|GT3|2.4.1.11	8.79e-245	14	638	9	629
AAC98780.2|GT3|2.4.1.11	8.79e-245	14	638	9	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U77_A	2.57e-203	13	637	2	639	yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_B yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_C yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_D yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C]
4KQ1_A	3.38e-203	13	637	21	658	Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_B Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_C Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_D Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ2_A Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_B Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_C Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_D Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO]
3NB0_A	3.49e-203	13	637	22	659	Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_B Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_C Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_D Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3RT1_A Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_B Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_C Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_D Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],5SUL_A Inhibited state structure of yGsy2p [Saccharomyces cerevisiae S288C],5SUL_B Inhibited state structure of yGsy2p [Saccharomyces cerevisiae S288C]
5UX7_A	4.20e-203	13	637	22	659	Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_B Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_C Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_D Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C]
5SUK_A	4.94e-203	13	637	22	659	G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_B G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_C G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C],5SUK_D G6P bound activated state of yeast glycogen synthase 2 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O93869|GYS_NEUCR	1.56e-245	14	638	9	629	Glycogen [starch] synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gsy-1 PE=2 SV=2
sp|P27472|GYS2_YEAST	9.34e-203	13	637	2	639	Glycogen [starch] synthase isoform 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSY2 PE=1 SV=3
sp|P23337|GYS1_YEAST	4.31e-199	13	626	2	628	Glycogen [starch] synthase isoform 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSY1 PE=1 SV=3
sp|A2RRU1|GYS1_RAT	2.75e-191	21	617	29	618	Glycogen [starch] synthase, muscle OS=Rattus norvegicus OX=10116 GN=Gys1 PE=1 SV=1
sp|Q9Z1E4|GYS1_MOUSE	3.89e-191	21	617	29	618	Glycogen [starch] synthase, muscle OS=Mus musculus OX=10090 GN=Gys1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

There is no transmembrane helices in jhhlp_000523-t41_1-p1.